KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_002955Help
Entry
SEEB0189_002955   CDS       T02739                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb00061  Fatty acid biosynthesis
seeb00620  Pyruvate metabolism
seeb00640  Propanoate metabolism
seeb01100  Metabolic pathways
seeb01110  Biosynthesis of secondary metabolites
seeb01120  Microbial metabolism in diverse environments
seeb01130  Biosynthesis of antibiotics
seeb01200  Carbon metabolism
seeb01212  Fatty acid metabolism
Module
seeb_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEEB0189_002955
   00640 Propanoate metabolism
    SEEB0189_002955
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SEEB0189_002955
Enzymes [BR:seeb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SEEB0189_002955
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SEEB0189_002955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGQ57780
LinkDB All DBs
Position
complement(541741..543090)
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLGDDMNANRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSITQDEVVVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNIDL
QTRIMNDEHFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttggataaaattgtcatcgccaaccgcggcgagatcgcactacgtattcttcgagcc
tgtaaagaactcggcatcaagaccgtcgctgtgcactcaagcgcggatcgcgatttaaaa
cacgtattgctggcggatgagacggtctgtattggcccggcaccgtccgtaaaaagttat
ctgaacatcccggctatcattagcgccgctgaaatcaccggcgcggtggcaatccacccg
ggttacggcttcctttctgagaacgccaattttgccgagcaggttgaacgctccggcttt
atctttatcggcccgaaagcggacaccatccgcctgatgggcgataaagtgtccgcgatt
accgcgatgaaaaaagcgggcgtgccgaccgtaccaggatctgacggcccgctgggcgac
gatatgaatgcgaaccgcgctcatgccaaacgtattggctatccggtgatcatcaaagcg
tccggcggcggcggcggccgcggtatgcgcgtggttcgtagcgatgctgaactggcgcag
tccatctccatgactaaagcggaagcgaaagcggctttcagcaacgacatggtctacatg
gagaaatacctggaaaacccacgccacatcgaaattcaggtgctggcggacggccagggc
aacgctatctatctggcggaacgcgactgttccatgcagcgtcgccaccagaaagtggtt
gaagaagccccggcgccaggcattacgccggaactgcgtcgctatatcggcgaacgctgc
gcgaaagcgtgcgtagacatcggctatcgcggcgcagggacgttcgaattcctgttcgaa
aacggcgagttctatttcatcgaaatgaacacccgtattcaggttgaacacccggtgact
gaaatgattaccggcgtcgatttgatcaaagagcagttgcgcatcgcggcgggtcagccg
ctgtcgatcacacaggacgaagttgtcgttcgaggccatgcggtagaatgccgtatcaat
gccgaagatccgaacactttcctgccaagccctggcaaaatcacgcgcttccatgcgcct
ggcggctttggcgttcgctgggaatctcatatctacgcgggctacacggtgccgccgtac
tatgattccatgatcggcaaactcatctgctacggtgaaaaccgcgacgtggcgattgcc
cgtatgaaaaatgccctgcaggaactgattatcgatggtatcaaaaccaatatcgatctg
cagacccgcatcatgaatgacgagcacttccagcacggtggaaccaacatccactatctg
gagaaaaaactcggtcttcaggaaaagtaa

DBGET integrated database retrieval system