KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_013380Help
Entry
SEEB0189_013380   CDS       T02739                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb00020  Citrate cycle (TCA cycle)
seeb00480  Glutathione metabolism
seeb01100  Metabolic pathways
seeb01110  Biosynthesis of secondary metabolites
seeb01120  Microbial metabolism in diverse environments
seeb01130  Biosynthesis of antibiotics
seeb01200  Carbon metabolism
seeb01210  2-Oxocarboxylic acid metabolism
seeb01230  Biosynthesis of amino acids
Module
seeb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seeb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SEEB0189_013380
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SEEB0189_013380
Enzymes [BR:seeb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SEEB0189_013380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AGQ59418
LinkDB All DBs
Position
complement(2711237..2712487)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPVEGKKITLQNGKLNVPENPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLARDEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMDGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggtggaaggtaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgagaatccgattatcccgtttattgaaggcgatggtatcggtgttgat
gtcactccagccatgcttaaagtggtcgatgccgccgtcgagaaagcctataaaggcgag
cgtaaaatttcctggatggaaatttacaccggagaaaaatccacacaggtttacggccag
gatgtctggcttcccgctgaaacccttgatttaattcgtgactaccgagtagcgattaaa
ggtccattgaccacgccggttggcggcggtatccgctctctgaacgttgccctgcgtcag
gagcttgacctgtacgtttgtctgcgtcccgttcgttactatcagggcacgccaagtccg
gtgaaacatccggagctgaccgatatggtcatcttccgtgaaaactctgaagacatctac
gccggaattgaatggaaagctgactctgcagacgctgagaaagtgatcaagttcctgcgc
gaagagatgggcgtgaagaaaattcgcttcccggagcactgcggtatcggtatcaaaccg
tgttctgaagaaggcactaaacgtctggttcgcgcggcgattgaatacgctattaccaac
gatcgcgattccgttacgctggtacataaaggcaatatcatgaagttcaccgaaggcgcg
tttaaagactggggctaccagttggcgcgcgacgagttcggcggtgagcttattgacggc
ggtccgtggctgaaaattaagaacccgaacacgggtaaagagatcgtggttaaagacgtt
atcgccgatgcgttcctgcaacagatcctgttgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggtgactatatttccgatgccctggcggctcaggttggcggtatc
ggtattgcaccgggtgcgaatatcggcgacgaatgcgcgttgtttgaagcgactcacggg
actgcgccgaaatatgcgggccaggataaagtcaacccaggctccattattctgtctgcg
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgttaaaggtatg
gaaggcgcgattgccgcgaagaccgtgacctatgacttcgaacgtctgatggacggcgct
aagctgctgaaatgtagtgagtttggtgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system