KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_014230Help
Entry
SEEB0189_014230   CDS       T02739                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb00061  Fatty acid biosynthesis
seeb01100  Metabolic pathways
seeb01212  Fatty acid metabolism
Module
seeb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SEEB0189_014230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:seeb01004]
    SEEB0189_014230
Enzymes [BR:seeb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SEEB0189_014230
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     SEEB0189_014230
Lipid biosynthesis proteins [BR:seeb01004]
 Fatty acid synthase
  Component type
   SEEB0189_014230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AGQ59564
LinkDB All DBs
Position
2877866..2878384
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TARKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTAHDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagaccttcttgcctctggtcgtggtgaa
ctgtttggcgctaaagggccgcaactccctgcgccgaacatgctgatgatggaccgcgtc
gttaagatgaccgaaacgggcggcaatttcgacaaaggctatgtcgaagccgagctggat
atcaatccggatctatggttcttcggatgccactttatcggcgatccggtgatgcccggt
tgtctgggtctggatgctatgtggcaattggtgggattctacctgggctggttgggcggc
gaaggcaaaggccgcgctctgggcgtgggcgaagtgaaatttaccggccaggttctgccg
acagccaggaaagtcacctatcgcattcatttcaaacgtatcgtaaaccgtcgcctgatc
atgggtctggcggacggtgaggttctggtggatggtcgtctgatctataccgcacacgat
ttgaaagtcggtttgttccaggatacttccgcgttctaa

DBGET integrated database retrieval system