KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_017985Help
Entry
SEEB0189_017985   CDS       T02739                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb03030  DNA replication
seeb03430  Mismatch repair
seeb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:seeb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SEEB0189_017985
   03430 Mismatch repair
    SEEB0189_017985
   03440 Homologous recombination
    SEEB0189_017985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:seeb03032]
    SEEB0189_017985
   03400 DNA repair and recombination proteins [BR:seeb03400]
    SEEB0189_017985
Enzymes [BR:seeb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SEEB0189_017985
DNA replication proteins [BR:seeb03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SEEB0189_017985
DNA repair and recombination proteins [BR:seeb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SEEB0189_017985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1 vATP-synt_AC39 HPIP
Motif
Other DBs
NCBI-ProteinID: AGQ60139
LinkDB All DBs
Position
complement(3669812..3670552)
Genome map
AA seq 246 aa AA seqDB search
MTDMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRRLTGNNFHVYLKPDRL
VDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNASFDIGFMDYEFGLLKRD
IPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHGALLDAQILAEVYLA
MTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFASEEELAAHESRLDLVQKKGG
SCLWRA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatgagcactgcaattacacgacagattgtcctcgataccgaaaccaccggt
atgaaccagataggcgcgcactatgaaggtcacaagattattgagatcggtgcggttgag
gtgataaaccgtcgtctgaccggcaacaattttcatgtttacctgaagcccgatcgcctt
gtcgatccagaggcttttggcgtacacggtattgccgatgagtttctgctggataagccg
gtttttgctgatgtggtcgatgagtttcttgattatatccgcggcgcggagctggtcatc
cataacgcatcgttcgatatcggctttatggattatgagtttggtctgcttaaacgcgat
attcctaaaaccaatactttctgcaaagttaccgacagcctggcgttggcgcggaaaatg
ttccccggcaagcgtaacagccttgatgcactgtgttcgcgttatgagatagataatagc
aaacgtactttgcacggcgcattgctcgatgcccagatccttgctgaagtgtatctggcg
atgacgggcggacaaacgtccatgacgtttgcgatggaaggagagacgcaacggcagcaa
ggtgaagcgaccattcagcgaatcgttcgccaggccagccggttacgggtcgtttttgcc
tctgaggaagagctggctgcgcatgaatcgcggcttgatctggtgcagaaaaagggcgga
agttgcctttggcgggcgtaa

DBGET integrated database retrieval system