KEGG   Salmonella enterica subsp. enterica serovar Cubana: CFSAN002050_02790Help
Entry
CFSAN002050_02790 CDS       T02734                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
seec  Salmonella enterica subsp. enterica serovar Cubana
Pathway
seec00071  Fatty acid degradation
seec00280  Valine, leucine and isoleucine degradation
seec00281  Geraniol degradation
seec00362  Benzoate degradation
seec00592  alpha-Linolenic acid metabolism
seec01100  Metabolic pathways
seec01110  Biosynthesis of secondary metabolites
seec01120  Microbial metabolism in diverse environments
seec01130  Biosynthesis of antibiotics
seec01212  Fatty acid metabolism
Module
seec_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:seec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFSAN002050_02790 (fadA)
   00592 alpha-Linolenic acid metabolism
    CFSAN002050_02790 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFSAN002050_02790 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CFSAN002050_02790 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFSAN002050_02790 (fadA)
   00642 Ethylbenzene degradation
    CFSAN002050_02790 (fadA)
Enzymes [BR:seec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     CFSAN002050_02790 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGQ71448
LinkDB All DBs
Structure
PDB: 

Position
complement(255843..257006)
Genome map
AA seq 387 aa AA seqDB search
MEQVVIVDAIRTPMGRSKGGAFRNVRAEDLSAHLMRSLLARNPSLTAATLDDIYWGCVQQ
TLEQGFNIARNAALLAEIPHSVPAVTVNRLCGSSMQALHDAARMIMTGDAQVCLVGGVEH
MGHVPMSHGVDFHPGLSRNVAKAAGMMGLTAEMLSRLHGISREMQDQFAARSHARAWAAT
QSGAFKTEIIPTGGHDADGVLKQFNYDEVIRPETTVEALSTLRPAFDPVSGTVTAGTSSA
LSDGAAAMLVMSESRARELGLKPRARIRSMAVVGCDPSIMGYGPVPASKLALKKAGLSAS
DIDVFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIALGHPLGCSGARISTTLINLM
ERKDAQFGLATMCIGLGQGIATVFERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggttgtcattgtcgatgctattcgcaccccgatgggccgttcgaagggcggc
gcgtttcgcaacgtgcgggcagaagatctctccgcccacttaatgcgtagcctgctggcg
cgtaatccgtcgcttacagcggcgaccctcgatgatatttactggggctgcgtacaacaa
acgctggagcaaggcttcaacattgcccgtaacgccgcgttgctggcagaaattccccat
tcggtaccggcggtcaccgtcaaccgtctgtgtggttcctcgatgcaggcgttacacgat
gcagcgcgaatgatcatgaccggcgatgcgcaggtttgtctggttggcggcgtggagcat
atggggcacgtgccgatgagccacggcgtggattttcacccgggtctgagccgcaacgtc
gccaaagcggcagggatgatggggctaacggcggaaatgctctcccgcctgcacggcatt
agccgggaaatgcaggaccagttcgccgcccgctctcacgctcgcgcctgggccgctacc
cagtctggcgcattcaaaacggagattatcccgactggcggtcatgatgcagacggcgtg
ttgaagcagtttaactacgatgaagtgatccgcccggaaaccacggtcgaagcgctatca
acgctgcgtccagcatttgatccggttagtggcacggtcacggcgggcacctcatccgcg
ctttccgatggcgcagccgccatgctggtaatgagcgaaagtcgtgcccgtgagctgggt
ctgaaacctcgcgcccgtattcgctcaatggcagtggtgggttgtgatccgtcaattatg
ggttacgggccggttccggcgtcaaaactggcgttgaaaaaagcgggactgtcagccagc
gatatcgatgtgtttgagatgaacgaagcgtttgccgcacagatcctgccatgcattaag
gatctgggattgatggagcaaatagacgagaagatcaacctcaacggcggcgcgatcgcg
cttggtcatccgctcggctgctccggagcacgtatcagcaccacgcttatcaacctgatg
gagcgcaaagacgcgcagtttggtctggcgacgatgtgtattggtctgggtcagggcatc
gccacggtgtttgagcgggtttaa

DBGET integrated database retrieval system