KEGG   Salmonella enterica subsp. enterica serovar Cubana: CFSAN002050_10225Help
Entry
CFSAN002050_10225 CDS       T02734                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
seec  Salmonella enterica subsp. enterica serovar Cubana
Pathway
seec00020  Citrate cycle (TCA cycle)
seec00190  Oxidative phosphorylation
seec00650  Butanoate metabolism
seec01100  Metabolic pathways
seec01110  Biosynthesis of secondary metabolites
seec01120  Microbial metabolism in diverse environments
seec01130  Biosynthesis of antibiotics
seec01200  Carbon metabolism
Module
seec_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seec_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
seec_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:seec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFSAN002050_10225 (sdhB)
   00650 Butanoate metabolism
    CFSAN002050_10225 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFSAN002050_10225 (sdhB)
Enzymes [BR:seec01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFSAN002050_10225 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CFSAN002050_10225 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AGQ72554
LinkDB All DBs
Position
1814593..1815312
Genome map
AA seq 239 aa AA seqDB search
MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGV
CGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKP
YLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAY
RFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgt
atgcaggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgtta
atccagcttaaagaaaaagatcccagcctttctttccgccgttcctgccgcgaaggtgtg
tgtggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatt
tcggcgctgaaccagccgggtaagaagattgtgattcgcccgctacccggtttgccggtg
atccgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagcct
tacttattgaataatgggcaaaatccaccggctcgtgagcatctgcagatgccggagcag
cgtgaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgc
ccgtcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtat
cgattcctgatcgatagccgtgataccgagaccgacagtcgtctggaagggatgagcgat
gcattcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaaggga
ctgaacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcataa

DBGET integrated database retrieval system