KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_13650Help
Entry
CFSAN002050_13650 CDS       T02734                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
seec  Salmonella enterica subsp. enterica serovar Cubana
Pathway
seec00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CFSAN002050_13650
Enzymes [BR:seec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CFSAN002050_13650
Transporters [BR:seec02000]
 Other Transporters
  Pores ion channels [TC:1]
   CFSAN002050_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_C_2 GST_N GST_N_3 GST_C_6 Glutaredoxin2_C Tom37
Motif
Other DBs
NCBI-ProteinID: AGQ73080
UniProt: S5HUU8
LinkDB All DBs
Position
complement(2486967..2487572)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGGCSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPET
LKPAVRAGLEKKLQYVDESLSDDQWICGQRFTIADAYLFTVLRWAYGVKLNMDGLTHIES
YMQRVAKRPTVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtggctgctctcttgcttcccatattaccctgcgcgaa
attggcaaagactttacgcttgatggcgtcgatctcgcaaaaaaacgcctggaaaacggt
gatgattacctggcagtcaaccctaaaggacaggttccggctctgctgctggatgacggc
acactgttgactgaaggcgtcgccattatgcagtacctcgccgacagcgttcccgaccgc
cagcttctggcgccggtaagtagtcttgctcgctatcatacgctggaatggctcaactat
attgcaacggaactgcataaaggctttaccccgctgttccgccctgacacgccggaaaca
cttaaacccgccgttcgcgccggtctggaaaagaaattgcagtatgtggatgagtcgctt
tcagacgaccagtggatttgcggccagcgttttaccattgcagacgcttatctgtttacc
gtattgcgttgggcctatggcgtaaaactgaatatggacgggttaacgcatattgaaagt
tatatgcagcgtgtcgcaaaaagaccgaccgttgcggcagcgcttaaagcggaaggactg
aattaa

DBGET integrated database retrieval system