KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_03515Help
Entry
SEEH1578_03515    CDS       T02736                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seeh01100  Metabolic pathways
seeh01110  Biosynthesis of secondary metabolites
seeh01130  Biosynthesis of antibiotics
seeh01230  Biosynthesis of amino acids
Module
seeh_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SEEH1578_03515 (aroK)
Enzymes [BR:seeh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SEEH1578_03515 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA AAA_16 APS_kinase TsaE AAA_22 ABC_tran AAA_7 AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_25 AAA_28 AAA_29 RsgA_GTPase His_biosynth PduV-EutP Mg_chelatase AAA_2 AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: AGQ62306
LinkDB All DBs
Position
complement(579389..579910)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
NREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgttgaaggtgaagacggcttccgt
aatcgtgaagaaaaagttatcaacgaattgacggaaaaacagggtattgtgctggcaacc
ggcggtggctctgtaaaatcgcgtgaaacgcgtaaccgtctctccgcgcgtggcgtcgtg
gtctaccttgaaacgaccatcgaaaaacaactggcgcgcacgcagcgtgataaaaaacgc
ccgctgttgcaggttgaagcgccgcctcgcgaagttctggaagcgctggctaacgaacgc
aatccgctgtacgaagagattgccgacgtcaccattcgcaccgacgatcaaagcgctaag
gttgtggcaaaccagattattcatatgctggaaagcaactaa

DBGET integrated database retrieval system