KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_04175Help
Entry
SEEH1578_04175    CDS       T02736                                 

Gene name
bcsA
Definition
(GenBank) cellulose synthase catalytic subunit
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00500  Starch and sucrose metabolism
seeh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SEEH1578_04175 (bcsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:seeh01003]
    SEEH1578_04175 (bcsA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:seeh02000]
    SEEH1578_04175 (bcsA)
Enzymes [BR:seeh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     SEEH1578_04175 (bcsA)
Glycosyltransferases [BR:seeh01003]
 Polysaccharide
  Structural polysaccharide
   SEEH1578_04175 (bcsA)
Transporters [BR:seeh02000]
 Other Transporters
  Others
   SEEH1578_04175 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: AGQ62438
LinkDB All DBs
Position
complement(737561..740185)
Genome map
AA seq 874 aa AA seqDB search
MSALSRWLLIPPVSARLSERYQGYRRHGASPFSAALGCLWMILAWIVFPLEHPRWQRIRD
GHKALYPHINAARPRPLDPARYLIQTLWLVMISSTKERHEPRWRSFARLKDVRGRYHQWM
DTLPERVRQKTTHLEKEKELGHLSNGARRFILGVIVTFSLILALICITQPFNPLSQFIFL
LLLWGVALLVRRMPGRFSALMLIVLSLTVSCRYIWWRYTSTLNWDDPVSLVCGLILLFAE
TYAWIVLVLGYFQVVWPLNRQPVPLPKEMSQWPTVDIFVPTYNEDLNVVKNTIYASLGID
WPKDKLNIWILDDGGRESFRHFARHVGVHYIARTTHEHAKAGNINNALKHAKGEFVAIFD
CDHVPTRSFLQMTMGWFLKEKQLAMMQTPHHFFSPDPFERNLGRFRKTPNEGTLFYGLVQ
DGNDMWDATFFCGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAA
GLATESLSAHIGQRIRWARGMVQIFRLDNPLFGKGLKLAQRLCYLNAMFHFLSGIPRLIF
LTAPLAFLLLHAYIIYAPALMIALFVIPHMVHASLTNSKIQGKYRHSFWSEIYETVLAWY
IAPPTLVALINPHKGKFNVTAKGGLVEEKYVDWVISRPYIFLVLLNLLGVAAGVWRYYYG
PENETLTVIVSLVWVFYNLVILGGAVAVSVESKQVRRAHRVEIAMPGAIAREDGHLFSCT
VHDFSDGGLGIKINGQAQVLEGQKVNLLLKRGQQEYVFPTQVVRVTGNEVGLQLMPLTTK
QHIDFVQCTFARADTWALWQDSFPEDKPLESLLDILKLGFRGYRHLAEFAPPSVKVIFRS
LTALIAWIVSFIPRRPERQAAIQPSDRVMAQAQQ
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccctttcccggtggctgcttatcccgccggttagcgcgcgtttgagcgagcgc
tatcagggttaccgccgccacggcgcgtcgccgtttagcgcagcgctcggctgcctgtgg
atgattctggcgtggatagtgtttccgcttgagcatccgcgctggcagcgtattcgcgac
gggcataaagcgctttatccgcatattaacgccgcccgcccgcgcccgctggacccggcc
cgttacctcattcagaccctctggctggtgatgatctcgtcgactaaagaacgtcatgaa
ccgcgctggcggtcatttgcgcgcctgaaggacgttcgtggacgttaccatcaatggatg
gataccttaccggaacgggtgcgccaaaagacaacgcatctggaaaaggaaaaagagctg
ggacatcttagcaacggcgcccggcgttttattctgggcgttatcgtgaccttttcactg
atactggcgctgatctgtattacgcagccatttaacccgctatcgcaatttatctttctg
ctgttgctgtggggcgttgcgctgttggtacgacgtatgccgggacgcttttccgcgctg
atgctcatcgtgctgtcgctaacggtctcctgtcgttatatctggtggcgctatacctcg
acgctaaattgggacgacccggtcagtctggtgtgcgggctgattctgctgtttgcggaa
acctacgcctggattgtgctggtgctggggtacttccaggtggtgtggccgttaaatcgt
caaccggtgccgttgccgaaagaaatgtcgcagtggccgacggtggatatttttgtaccg
acctataacgaagaccttaatgtggtcaaaaataccatttacgcttcgcttggcattgac
tggccgaaggacaagctgaatatctggatccttgatgacggcgggcgtgaatcatttcgt
cattttgcccgacatgttggcgtgcattacattgcccgcaccacgcatgaacacgccaaa
gccggcaacatcaacaatgcgctaaaacacgcgaaaggcgagtttgtggcgatcttcgat
tgcgaccatgtgccgacacgctcgtttctgcaaatgacaatgggctggttcctgaaagaa
aaacagctggcgatgatgcagacgccgcatcatttcttctccccggacccgtttgagcgc
aacctgggacgttttcgtaaaacgcctaacgaaggcacgctgttttacggactggtgcag
gacggtaacgatatgtgggacgccactttcttttgcggatcgtgcgcggtgattcgccgt
aagccgctggatgagattggcggtatcgccgttgagacggtgacggaagatgcgcatact
tcgctccggctgcaccggcgaggttatacctcagcgtatatgcgcattccgcaggcggcg
gggctggcgacggaaagcctgtcggcgcatatcgggcagcgtattcgttgggcgcggggc
atggtgcaaattttccgcctcgataaccctctgtttggtaaaggcttaaaactggcgcag
cggctgtgctacctcaacgcgatgttccatttcttgtccggcattccgcgcctgatcttt
ctgaccgcgccgctggcttttctgctgctgcacgcctatatcatttatgcgcctgcgttg
atgattgcgctatttgtgataccgcacatggtccacgccagcctgactaactcgaagatt
cagggcaagtatcgtcactctttctggagtgaaatctatgaaacggtactggcatggtat
atcgcaccgccgactctggtcgcgttgatcaatccgcacaaagggaaatttaacgtcacg
gcgaaaggcgggctggtggaagagaagtacgtcgactgggtaatctcgcgtccgtatatc
ttccttgtcttgcttaacctgctcggcgtggcggcgggcgtatggcgatactattacggg
ccggaaaatgaaacgctgaccgtcatcgttagcctggtgtgggtcttctataacctggtc
attctcggcggcgcggttgcggtttcggtagagagtaaacaggtcaggcgcgcgcatcgg
gtcgagattgccatgccgggggccatcgcccgcgaagatggacatttgttctcctgtacc
gtacatgacttctccgacggcgggttaggcatcaagatcaacggtcaggcgcaggtgctg
gaagggcagaaagtgaatctgttgcttaaacgcgggcagcaggaatatgtctttccaacg
caggtggtgcgcgtaacgggcaatgaggtcggactacaactgatgccgctcaccaccaaa
caacatattgattttgtgcagtgtaccttcgcgcgcgccgatacgtgggcgctttggcaa
gatagcttcccggaagataaaccgctggaaagcttgctggatattctgaagctgggcttc
cgcggatatcgccacctcgcggaattcgcgccgccttcagtaaaagtaattttccgatcg
ttgacggcgttaattgcctggattgtatcgtttattccgcgtcgcccggagcggcaagcg
gcgatacagccgtcggatcgggttatggctcaggctcaacaatga

DBGET integrated database retrieval system