KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_08595Help
Entry
SEEH1578_08595    CDS       T02736                                 

Definition
(GenBank) tryptophanyl-tRNA ligase II
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SEEH1578_08595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:seeh01007]
    SEEH1578_08595
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seeh03016]
    SEEH1578_08595
Enzymes [BR:seeh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     SEEH1578_08595
Amino acid related enzymes [BR:seeh01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SEEH1578_08595
Transfer RNA biogenesis [BR:seeh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SEEH1578_08595
 Prokaryotic type
    SEEH1578_08595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AGQ63318
LinkDB All DBs
Position
complement(1700350..1701363)
Genome map
AA seq 337 aa AA seqDB search
MNTLPIILTGDRPTGSLHLGHYVGSLRQRVALQQDHQQYVLIADLQGLTDNGSNPQKIRD
NIPQVLADYLAVGIDPALTTICLQSALPALAELTVLYMNIVTVARVERNPTVKNEIAQKG
FTRSLPVGFMAYPISQAADITAFKAEMVPVGDDQLPMIEQTNEIVHKMNSLFSSPVLRPC
QALLSDTGRLPGIDGSAKMSKSLGNTLLLSASEETIHRAVSAMYTDPNHLKISDPGKIEG
NVVFTWLDAFHPDKAKVAAMKAHYQQGGLGDRVCKNELETCLQELIAPIRERRATFIADK
GMLMELLKKGSERAHEVTQKTLQEVKRGLGLPTLFQI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccttcctatcattctgactggcgatcgccccaccggctcgctgcacctcggc
cattatgtcggttcactgcgccagcgcgtcgcgctacagcaggatcaccaacagtatgtc
ctgattgccgacctgcagggactcaccgataacggcagtaatccgcaaaaaatccgcgat
aatattccgcaggtgttagctgactatctggccgtcggcatcgatcccgcgctaacgacg
atctgcctgcaatccgcgttacccgccctcgctgaattaacggtgctgtatatgaatatt
gttaccgtcgcccgagtggagcgtaatcctacggtaaaaaatgagattgcccaaaaaggc
tttacccgttccctgccggtcgggttcatggcgtatcccattagccaggcggcagatatc
accgcctttaaggccgaaatggtaccggttggcgacgaccaattgcccatgattgagcaa
acgaatgagatcgttcataagatgaatagtcttttctcctcgccggtattgcgaccctgt
caggcgctcctgagcgatacgggccgtctgccaggcattgacggcagcgccaagatgtcg
aaatcgctcggcaataccctgcttctttccgccagcgaagagaccatccaccgtgcggtc
agcgcgatgtacaccgatcccaaccatttaaaaattagcgatccgggaaaaatagaaggt
aacgtcgtctttacgtggctggatgcgttccatccggataaagccaaagtcgcggcgatg
aaagcacattatcaacaaggcggattaggcgaccgtgtctgtaaaaatgagctggagacc
tgcctgcaagaactgatcgcgcccatacgcgaacgacgggcaacctttattgcggataag
ggaatgctaatggaattgctgaaaaaaggtagcgagcgggcgcatgaggtcactcaaaag
acgctacaggaagtaaaacgtggactgggtctgcccacgctattccagatataa

DBGET integrated database retrieval system