KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_13070Help
Entry
SEEH1578_13070    CDS       T02736                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
seeh00020  Citrate cycle (TCA cycle)
seeh00190  Oxidative phosphorylation
seeh00650  Butanoate metabolism
seeh01100  Metabolic pathways
seeh01110  Biosynthesis of secondary metabolites
seeh01120  Microbial metabolism in diverse environments
seeh01130  Biosynthesis of antibiotics
seeh01200  Carbon metabolism
Module
seeh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seeh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
seeh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:seeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SEEH1578_13070 (sdhA)
   00650 Butanoate metabolism
    SEEH1578_13070 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SEEH1578_13070 (sdhA)
Enzymes [BR:seeh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SEEH1578_13070 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SEEH1578_13070 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AGQ64207
LinkDB All DBs
Position
2638843..2640609
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGVLRDASESDVEGSLERLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDANWLCHTLYQPQTESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccaaacctgtgcgctgctctcgaaagtcttc
ccgacccgttcccataccgtttccgcgcagggcggtatcaccgtggcgctcggcaatacc
catgaagataactgggaatggcacatgtacgacaccgttaaggggtcggactacattggt
gaccaggatgccatcgaatatatgtgtaagaccggaccggaagcgattctggaactggag
cacatggggctaccgttctcccgtcttgatgatggacgtatctatcagcgcccgttcggc
ggccagtcgaaaaactttggcggcgagcaggcggcacgtaccgcggcggcggctgaccgt
accggtcacgccttgctacacacgctgtatcaacagaatttgaaaaaccacaccacgatt
ttctccgaatggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtggggtgt
accgcactgtgcatcgaaaccggtgaagtggtgtacttcaaagcccgcgcgacggtgctg
gcgaccggcggcgcaggccgtatctaccagtccaccaccaacgctcacatcaacaccggt
gacggtgtcggtatggcgctgcgtgccggtgtcccggtgcaggacatggaaatgtggcag
ttccacccgaccggcatcgccggggcgggcgtgctggtgacagaaggctgccgcggcgaa
ggcggttacctgctgaacaaacacggcgagcgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggtcgtgacgtggtggcgcgttccatcatgatcgaaatccgtgaaggc
cgcggctgtgatggtccgtgggggccgcacgctaaactgaaactggatcacctgggtaaa
gaggtgctggaatctcgcctgccgggtatcctggagctgtcccgtactttcgcccacgtt
gacccggtgaaagagccgattccggttatcccgacctgccactacatgatgggcggtatt
ccgactaaagtgaccggtcaggcgctgaccgtgaacgagcagggcgaagacgtggtcatt
ccggggctgtttgcggtaggcgaaatcgcctgtgtatcggttcacggcgccaaccgtctg
ggcggtaactcactgctggatctggtggtctttggccgcgcggcggggctgcatttacag
gaatccatcgccgagcagggcgtgctgcgcgacgccagcgagtctgacgttgaaggttct
ctggagcgcctgaatcgctggaacaataaccgcaatggcgaagatccggtggctatccgc
aaagcgttgcaggagtgtatgcagcataacttctccgtattccgtgaaggcgacgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaacgcccgtctggat
gacacgtccagcgagtttaatacccagcgtgttgagtgtctggagctggataacctgatg
gaaaccgcctacgccactgccgtatcagccaacttccgaacggaaagccgcggcgcgcat
agccgcttcgatttcccggagcgtgatgatgccaactggttgtgtcataccctgtatcag
ccgcaaacggaatccatgacgcgccgaagcgtcaatatggagccgaaactgcgtccggcg
ttcccgccgaagattcgtacttattaa

DBGET integrated database retrieval system