KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_16925Help
Entry
SEEH1578_16925    CDS       T02736                                 

Definition
(GenBank) Starvation sensing protein RspB
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C TrkA_N Pyr_redox_2 DAO Peptidase_M55 Pyr_redox_3 Pyr_redox ADH_zinc_N_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGQ64974
LinkDB All DBs
Position
complement(3412151..3413176)
Genome map
AA seq 341 aa AA seqDB search
MKVKAVFINKPGEVETLWVDYPHKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQEGTGMPDNIKKGDRVIVDPYIYCGHCYPCSVGRTNCCENLNVIGVHVDGAM
QEVVTHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEYVAIIGAGAIGLMAA
LSARHYKATPILIDIVEERLRYAQKLGVPYVLNAADDQVIDAIKNITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETSLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKVVNLDEIPDAVKELDRYPERYLKINAVFH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgttcattaataagcctggtgaagttgaaaccctctgggtggat
tatccccataagaaagaaaatgaagtattaattaaggttgatgccgcaggcatttgcgga
tcggatatcggggcttttcgtggaacgaacccactggttacttacccaagaattattggg
catgaagtgaccggaattgttcttcaggaaggtaccggaatgccggacaatattaaaaaa
ggcgaccgcgtgattgttgacccttatatttattgtggtcactgctacccttgctctgtc
ggcagaactaattgttgtgaaaatttaaacgtcattggcgtgcatgtcgatggcgcaatg
caggaggtggttactcatcctgcacatttaattcataaaataccagataatgtgccttct
gaaatggcgccgctggcagaaccgctgactatcgctctgcacgcgctgcatcgggcaaac
gttaaggccggggagtatgttgccatcatcggcgcgggggccattggtcttatggcggca
ttaagcgcgcgacattacaaggcaacgcctattctgatcgatattgtggaagaaaggtta
cgctatgcgcaaaagcttggcgttccttatgtgctgaacgccgctgacgatcaggttatc
gacgctattaaaaatatcacccacggcaccatggcgcaggtcgtgatagaagcctccggc
gcaaatagcgctattcgaaatacgcttgatttagcatcgtttgctggtcgtatttcgttt
accggatggccaaaacaggaaacgtcgctgccgacgaacctgatcacctacaaagaactg
gatttacgcggttcccgcaccagtgccggtgaatttgatgaggcattacgtatgctgtct
acgttggagattaatccgcaagatgttgtcagtaaggtcgtcaatcttgatgagatccct
gatgcagttaaagaacttgatcgctatccggagcgctacttaaagattaatgctgttttc
cattga

DBGET integrated database retrieval system