KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_03280Help
Entry
SE451236_03280    CDS       T02738                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00564  Glycerophospholipid metabolism
seen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SE451236_03280 (glpD)
Enzymes [BR:seen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SE451236_03280 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 3HCDH_N Pyr_redox_2 FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-GeneID: 16386147
NCBI-ProteinID: AGQ84433
LinkDB All DBs
Position
complement(708370..709878)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYVWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAAYVEKHQLSMAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcaggcatcgcggct
gatgccgccgggcgcggtttgtccgtactcatgctggaagcgcaggatttggcctgcgca
acctcttccgccagttcgaaacttatccacggcggcttacgctaccttgagcactacgag
ttccgtctggtcagcgaagcgctggcagaacgtgaagtgctgttgaaaatggcgccgcac
atcgccttcccgatgcgttttcgtctgccgcaccgcccgcatttacgtccggcctggatg
atccgtatcggtctgtttatgtacgatcacctcggcaaacgtaccagtttacccggttcc
accggtgtgcggtttggcgcagattcggtgctcaaaccggaaatcgtgcgcggattcgaa
tattccgactgctgggtagacgatgcgcgtctggtgctggctaacgcacagatggtggtg
cgtaaaggcggcgaagtccttacccgtactcgcgcaaccgccgctcgtcgggaaaatggc
ctgtggattgtcgaagcggaagatatcgacaccggtaaaaaatatgtctggcaggcgcgc
ggactggttaacgccaccggaccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccatatggcatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtccat
aatcagaagcaggcgtatattctgcaaaacgaagataagcgtatcgtctttgtcattccg
tggatggaagagttttcgatcattggcacgaccgatgtcgaatataaaggcgatccgaaa
gcggtaaaaattgaagagagcgaaattaattacctgttgaaggtttataacgcgcacttc
cagaaacaactggggcgcgatgacatcgtctggacgtactccggcgtccgtccgctgtgc
gatgatgagtccgactcaccgcaggcgatcactcgcgattatacccttgatattcatgat
gaaaacggcaaagcgccgctgctttccgtgtttggcggtaagctcacgacctaccgtaag
ctggctgaacacgcgatggaaaaactggcgtcttattatccaggcatcgggccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcg
aagctgcgtcgtcgttatccgttcctgacggaatcgctggcgcgccactattcgcgcact
tacggcagcaacacggagtggattctcggcgaagccacgtcgctgcttgatttaggcgaa
gatttcggtcatgagttttacgaggcggaactcaagtacctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgtcgcaccaaagaaggcatgtggctgaccgccgaa
cagcagtcccgcatcacccagtggctggcggcgtatgttgagaaacaccaactttcaatg
gcgtcgtaa

DBGET integrated database retrieval system