KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_03470Help
Entry
SE451236_03470    CDS       T02738                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seen01100  Metabolic pathways
seen01110  Biosynthesis of secondary metabolites
seen01130  Biosynthesis of antibiotics
seen01230  Biosynthesis of amino acids
Module
seen_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SE451236_03470 (aroK)
Enzymes [BR:seen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SE451236_03470 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA AAA_16 APS_kinase TsaE AAA_22 ABC_tran AAA_7 AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_25 AAA_28 AAA_29 RsgA_GTPase His_biosynth PduV-EutP Mg_chelatase AAA_2 AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-GeneID: 16386185
NCBI-ProteinID: AGQ84468
LinkDB All DBs
Position
755663..756184
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
NREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgttgaaggtgaagacggcttccgt
aatcgtgaagaaaaagttatcaacgaattgacggaaaaacagggtattgtgctggcaacc
ggcggtggctctgtaaaatcgcgtgaaacgcgtaaccgtctctccgcgcgtggcgtcgtg
gtctaccttgaaacgaccatcgaaaaacaactggcgcgcacgcagcgtgataaaaaacgc
ccgctgttgcaggttgaagcaccgcctcgcgaagttctggaagcgctggctaacgaacgc
aatccgctgtacgaagagattgccgacgtcaccattcgcaccgacgatcaaagcgctaag
gttgtggcaaaccagattattcatatgctggaaagcaactaa

DBGET integrated database retrieval system