KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_03475Help
Entry
SE451236_03475    CDS       T02738                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seen01100  Metabolic pathways
seen01110  Biosynthesis of secondary metabolites
seen01130  Biosynthesis of antibiotics
seen01230  Biosynthesis of amino acids
Module
seen_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SE451236_03475 (aroB)
Enzymes [BR:seen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     SE451236_03475 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-GeneID: 16386186
NCBI-ProteinID: AGQ84469
LinkDB All DBs
Position
756241..757329
Genome map
AA seq 362 aa AA seqDB search
MERITVTLGERSYPITIAAGLFNEPASFLPLKSGDQVMLVTNETLAPLYLDKVRGVLERA
GVNVDSVILPDGEQYKSLTVLDTVFTALLKKPHGRDTTLVALGGGVIGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPARELTS
GLAEVIKYGIILDADFFTWLEGNLDALLRLDGPAMAYCIRRCCELKAEVVAADEREAGLR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGIVMAARASERLGQFSSADTQRIIALLERA
GLPVNGPCEMSAQDYLPHMLRDKKVLAGELRLVLPLAIGKSEVRGGVSHEVVLSAIADCQ
QA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagaggattacagtcactctcggggaacgtagttacccgatcaccatcgcggctggt
ttgtttaacgaaccagcttcattcttgccgctgaaatcaggcgatcaggtcatgttagtg
accaacgaaaccctggcgccgctttatctggacaaggttcgcggcgtactcgaacgggcg
ggcgttaacgtagacagcgtgattcttcctgacggcgagcagtataagagcctgacggtg
ctggatacggtgtttacggcgttactgaaaaaaccgcatggtcgtgataccacgctggtc
gcgcttggcggcggcgtgattggcgatctcaccggttttgcggcggccagctaccagcga
ggcgttcgtttcatccaggtgccaactaccttactgtcgcaggttgattcttccgtgggc
gggaagaccgccgtcaaccatccccttggcaaaaacatgattggcgcgttttaccaaccc
gcttctgtggttgtcgatcttgattgcctgaaaacgcttcccgcacgcgaactgacatcg
ggactggcagaggtgatcaaatacggcattatactcgacgcggacttcttcacctggctt
gaaggtaatctggatgcgctattgcgtctggacggcccggcgatggcgtactgtattcgt
cgttgttgcgagctgaaagccgaagttgttgccgccgacgagcgtgaagcgggcttacgt
gctttactgaatcttggacatacctttggccacgccattgaagcggaaatgggatatggc
aattggttacatggtgaagccgttgccgcaggtatagtgatggctgcacgcgcatccgag
cgtttagggcagttcagttctgctgatacgcagcgcatcatcgctctactcgaacgggcc
gggttgccagtcaatggcccttgcgagatgtccgcgcaggactatttgccgcacatgctg
cgagataaaaaagtgttagcgggggagctgcgtttagtgcttccgctggccatagggaaa
agtgaagtgcgcggcggagtgtcgcacgaagtcgttcttagcgcgattgctgactgtcag
caggcgtga

DBGET integrated database retrieval system