KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_07915Help
Entry
SE451236_07915    CDS       T02738                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00473  D-Alanine metabolism
seen00550  Peptidoglycan biosynthesis
seen01100  Metabolic pathways
seen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:seen00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SE451236_07915
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SE451236_07915
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SE451236_07915
Enzymes [BR:seen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SE451236_07915
Peptidoglycan biosynthesis and degradation proteins [BR:seen01011]
 Precursor biosynthesis
  Amino acid ligase
   SE451236_07915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-GeneID: 16387073
NCBI-ProteinID: AGQ85175
LinkDB All DBs
Structure
PDB: 

Position
complement(1721970..1723064)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDAENYLQN
ADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGL
PLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALERHTANNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattgcgggtaggaatagtatttggcggtaagtcggcggaacatgaagtgtct
ttgcaatcagcgaaaaatatcgttgatgcgatcgataaaacccgcttcgacgtggtgctg
ttagggatagataaggcgggacaatggcatgttaacgatgcggaaaattatttgcagaat
gcagacgatccggcacatatcgcgctacgtccttcggcaatcagtctggcccaggtgcct
ggcaaacaccaacaccaattgattaacgctcagaacgggcagccgctaccgacggtagat
gttatttttcctatcgtccacggtacgctgggcgaagacggctcattgcaggggatgctg
cgcgtcgcaaacttaccgtttgtcggttcagacgtgctgagctccgcagcctgcatggat
aaagacgtcgccaaacgactgctacgcgatgccggactgaatatcgccccgtttattaca
ctcacccgaacgaatcgtcacgcgtttagttttgccgaggttgaatcccgtctgggactg
ccgctgttcgttaagcccgccaatcagggctcttcggtcggcgtcagtaaagtcgctaac
gaagcgcaatatcagcaggcggtcgcgctggctttcgaattcgatcataaagtggtggtg
gagcaagggatcaaagggcgcgagatcgaatgcgccgtattaggtaacgataacccacag
gccagtacctgcggcgaaatcgtactgaacagcgaattttacgcctacgatactaagtat
attgatgataatggcgcacaagttgtcgtgcctgcgcagatcccttccgaggtgaatgac
aagatccgcgcgatcgcgatccaggcttatcagacgctgggatgcgcgggtatggcgcgt
gtcgatgtcttcttaacggcagacaatgaggtcgtgattaacgagatcaatacgctgcca
ggttttaccaatatcagtatgtatccaaaactctggcaggcgagcggactgggctatacc
gatttgatcagccgtctgattgagctggcgctggaacgccatacggcgaataacgcctta
aaaaccacgatgtaa

DBGET integrated database retrieval system