KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_09695Help
Entry
SE451236_09695    CDS       T02738                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00020  Citrate cycle (TCA cycle)
seen00190  Oxidative phosphorylation
seen00650  Butanoate metabolism
seen01100  Metabolic pathways
seen01110  Biosynthesis of secondary metabolites
seen01120  Microbial metabolism in diverse environments
seen01130  Biosynthesis of antibiotics
seen01200  Carbon metabolism
Module
seen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
seen_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SE451236_09695 (sdhB)
   00650 Butanoate metabolism
    SE451236_09695 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SE451236_09695 (sdhB)
Enzymes [BR:seen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SE451236_09695 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SE451236_09695 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-GeneID: 16387427
NCBI-ProteinID: AGQ85460
LinkDB All DBs
Position
2088734..2089453
Genome map
AA seq 239 aa AA seqDB search
MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGV
CGSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKP
YLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAY
RFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgt
atgcaggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgtta
atccagcttaaagaaaaagatcccagcctttctttccgccgttcctgccgcgaaggtgtg
tgcggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatt
tcggcgctgactcagccgggtaagaagattgtgattcgcccgctgcccggtttgccggtg
atccgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagcct
tacttattgaataatgggcaaaatccaccggctcgtgagcatctgcagatgccggagcag
cgtgaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgc
ccgtcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtat
cgattcctgatcgatagtcgtgataccgagactgacagtcgtctggaagggatgagcgat
gcattcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaaggga
ctgaacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcataa

DBGET integrated database retrieval system