KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_13750Help
Entry
SE451236_13750    CDS       T02738                                 

Definition
(GenBank) formate dehydrogenase-N subunit beta
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seen00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SE451236_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4_21 Fer4 Fer4_17 Fer4_4 Fer4_16 Fer4_3 GP120 Fer4_18 Fer4_8 Fer4_20 Fer4_22
Motif
Other DBs
NCBI-GeneID: 16388238
NCBI-ProteinID: AGQ86105
LinkDB All DBs
Position
complement(2896160..2897044)
Genome map
AA seq 294 aa AA seqDB search
MSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVG
HCVGVYDNPADLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKKEMLELGEQRVEKLKARGFEHAGIYNPQGVGGTHVMYVLHHANQPELYHGL
PKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIGPNKETDDDEEDHHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtctatggaaacgcaggacattattaaacggtccgcaacaaacgccatcacgccgcct
ccgcaggcgcgtgattacaaagccgaagtcgcgaaactgatcgacgtctcctcctgtgtc
ggctgtaaagcctgccaggtagcctgttctgaatggaacgatattcgcgataacgttggt
cattgtgtcggggtgtacgataaccctgccgatctcagcgccaagtcctggacggtgatg
cgctttaccgaaaccgagcagaacggcaagctggagtggctgattcgtaaagatggttgt
atgcactgtgaagatccaggctgtcttaaagcctgtccatctgccggggctatcatccag
tacgcgaacgggattgttgattttcaatctgaacactgtatcggctgtggttactgtatc
gccgggtgtccgtttaatattccgcgcctcaacaaagaggacaaccgcgtttataaatgt
acgctctgcgtcgatcgcgtcagcgtgggccaggaaccggcctgcgtcaaaacttgtccg
accggggctattcacttcggcaccaaaaaagagatgctggaactgggtgagcaacgcgtg
gagaagttaaaagcgcgcggctttgaacatgccggtatctacaacccgcagggcgtcggc
ggtacgcacgtcatgtatgtgctgcaccatgccaatcagccggagttgtaccacggcttg
ccgaaagatccgcagatcgatacctcaatcaatctgtggaaaggggcgctaaaaccgctg
gccgcagcgggctttatcgccactttcgccggtctgatttaccactacatcggtattggc
ccgaataaagaaacggacgacgatgaggaggatcatcatgagtaa

DBGET integrated database retrieval system