KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_22605Help
Entry
SE451236_22605    CDS       T02738                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:seen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SE451236_22605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:seen01002]
    SE451236_22605
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:seen01011]
    SE451236_22605
Enzymes [BR:seen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SE451236_22605
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SE451236_22605
Peptidases [BR:seen01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   SE451236_22605
Peptidoglycan biosynthesis and degradation proteins [BR:seen01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SE451236_22605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase TrbL
Motif
Other DBs
NCBI-GeneID: 16390005
NCBI-ProteinID: AGQ87527
LinkDB All DBs
Position
4718034..4719467
Genome map
AA seq 477 aa AA seqDB search
MRFSRFIIGLTTSIAFSVQAANIDEYIKQLPAGANLALMVQKIGAPAPAIDYHSQQMALP
ASTQKVITALAALIQLGPDFRFTTTLETKGNVDNGILKGDVIARFGGDPTLKRQDIRNMV
ATLKKSGVTQIDGNVLIDTSIFASHDKAPGWPWNDLTQCFSAPPAAAIVDRNCFSVSLYS
AQKPNDLAFIRVASYYPVTMFSQVRTLPRGSADAQYCELDVVPGDLNRYTLTGCLPQRAD
PLPLAFAIQDGASYAGAILKQELKEAGITYRGTLLRQTQVNEPGTIVASKQSAPLHDLLK
IMLKKSDNMIADTVFRMIGHVRFNVPGTWRAGSDAVRQILRQQAGIDIGNTIIADGSGLS
RHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGS
LQGVYNLAGFITTASGQRMAFVQYLSGYAVPPADQRNRRIPLVRFESRLYKDIYQNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttccagatttatcatcggattgaccaccagtatagcgttcagcgttcaggcc
gcgaatattgacgaatacatcaaacagcttccggccggcgccaacctcgcgctgatggtg
caaaagattggcgcgcccgcgccggctattgattatcatagtcagcagatggcgcttccc
gccagtacccaaaaggtgattaccgcgctggcggcgctgattcaactcggcccggatttc
cgttttacgaccacgctggagactaaaggcaacgtcgataacggcatcctgaaaggtgac
gtaattgcgcgcttcggtggcgatccaacgctaaaacgtcaggatattcgcaatatggtc
gcgacgctgaaaaagtccggcgtcacgcaaatcgacggcaatgtgcttatcgacacgtcg
attttcgccagccacgataaagcgccaggctggccgtggaacgacctgacgcagtgtttc
agcgcgcctcccgccgccgccattgttgaccgcaactgtttttctgtgtcgctttatagc
gcgcaaaaaccaaacgatttagcctttattcgcgtggcctcttattatccggtaacgatg
ttcagccaggtacggactctaccgcgcggttcggcagacgcgcagtattgcgagctggat
gttgtgcctggcgatttgaaccgttatacgcttaccggctgtttaccacagcgcgccgac
ccgctgccgctggcctttgctattcaggacggcgccagctacgcgggcgcgatcctcaag
caggaactgaaagaggccgggataacttaccgcggcacgctgctgcgccagacgcaggtt
aacgagcccggaacgatcgtcgccagtaaacagtcggcgccactgcacgatctgcttaag
attatgctgaaaaagtcagacaacatgatcgccgatactgtttttcggatgattggtcat
gtcaggtttaacgtgcctggcacctggcgggcgggatcggatgccgttcgccagatcctg
cgccaacaggcgggaattgatatcggcaataccattattgccgacggttccggtctttct
cgccataatctgatcgctcccgccacgatgatgcaggtgctgcaatatatcgcccaacac
gataacgagctgaactttatctctatgctgccgctggcgggctatgatggttcattacaa
taccgcgccgggctgcatcaggcgggcgtagacggtaaggtttcagcgaaaaccggatca
ctgcagggcgtgtataatctggcgggctttattaccaccgcaagcgggcaacggatggca
tttgtacaatatttgtccggctacgcggttccacctgccgatcagcgtaatcgccgaatc
ccgctggtacgcttcgagagtcggttgtataaggatatttatcagaataactga

DBGET integrated database retrieval system