KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_05055Help
Entry
I137_05055        CDS       T02790                                 

Definition
(GenBank) galactonate oxidoreductase
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ThiF Cupin_2 ADH_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGS62726
LinkDB All DBs
Position
1137135..1137998
Genome map
AA seq 287 aa AA seqDB search
MKNSKAILKTPGTMTIIAADIPVPKENEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGNRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATNIAVVDVLEKRLAMAERLGATTVINGAKEDTVALCQQFTDDMGADI
VFETAGSAVTTQQAPYLVMRGGKIMIVGTVAGDSAINFLKINREVSI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatactaaaaacgccgggcaccatgacaattatagcggctgat
attccagtaccaaaagaaaacgaagtattgatcaaagtggaatatgtcggtatttgcggt
tcagatgttcacggttttgaatccgggccattcattccgccgaaggatccaaatcaggaa
attggtctcggtcatgagtgtgctggtacggtcgttgcggtcggcaatcgggtaagcaaa
tttaagccaggcgatcgggttaatatcgagccgggcgtgccgtgcggccactgccgctat
tgtctggaaggaaaatacaatatttgtccggatgttgattttatggcgacgcagccgaat
tatcgcggggccttaacgcactatctgtgccatccggaaagttttacgtacaagcttccg
gacaatatggacactatggaaggtgcgctggtggaacctgctgctgttggaatgcacgcg
gcaatgctggcggatgtcaaaccgggtaagaaaatcgtcattctcggcgcgggctgcatt
ggtttaatgaccctgcaagcgtgtaagtgtctgggggcgaccaatatcgcggtagtggat
gtgctggaaaaacggctggcaatggctgaacgactgggcgcgacaaccgttatcaatggg
gcgaaagaagatactgtcgcgctctgccagcagttcaccgacgatatgggcgccgatatt
gtgtttgaaaccgccggttccgccgtcacaactcagcaagcgccgtatctggtcatgcgc
ggcgggaagatcatgattgttggcactgtcgcaggagattcagcgattaatttcctcaaa
attaaccgtgaagtctccatctag

DBGET integrated database retrieval system