KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_05855Help
Entry
I137_05855        CDS       T02790                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:seep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I137_05855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:seep02000]
    I137_05855
Enzymes [BR:seep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     I137_05855
Transporters [BR:seep02000]
 Other Transporters
  Pores ion channels [TC:1]
   I137_05855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_C_2 GST_N_3 GST_C_6 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AGS62842
LinkDB All DBs
Position
complement(1297524..1298105)
Genome map
AA seq 193 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVLEWLNYIATELHKGFTPLFRPDTPETLKPAVRAA
LEKKFQYVDESLSDDQWICGQRFTIADAYLFTVLRWAYGVKLNMDGLTHIESYMQRVAKR
PTVAAALKAEGLN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgctctcttgcttcccacattaccctgcgcgaa
attggcaaagactttacgcttgatggcgtcgatctcgcaaaaaaacgcctggaaaacggt
gatgattacctggcagtcaaccctaaaggacaggttccggctctgctgctggatgacggc
acactgttgactgaaggcgtcgccattatgcagtacctcgccgacagcgttcccgaccgc
cagcttctggcgccggtactggaatggctcaactatattgcaacggaactgcataaaggc
tttaccccgctgttccgccctgacacgccggaaactcttaaacccgccgttcgcgccgct
ctggaaaagaaatttcagtatgtggatgaatcgctttcagacgaccagtggatttgcggc
cagcgttttaccatcgcagacgcttatctgtttaccgtattgcgttgggcctatggcgta
aaactgaatatggacgggttaacgcatattgaaagttatatgcagcgtgtcgcaaaaaga
ccgaccgttgcggcagcgcttaaagcggaaggactgaattaa

DBGET integrated database retrieval system