KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_07480Help
Entry
I137_07480        CDS       T02790                                 

Definition
(GenBank) RNA chaperone/anti-terminator
  KO
K03704  cold shock protein
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Brite
KEGG Orthology (KO) [BR:seep00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    I137_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: AGS63087
LinkDB All DBs
Position
complement(1645508..1645717)
Genome map
AA seq 69 aa AA seqDB search
MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKG
PAAVNVTAI
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagattaaaggtcaagttaagtggttcaacgaatccaaaggttttggcttcatt
actccggctgacggcagcaaagatgtgttcgtacacttctccgctatccagggcaatggt
ttcaaaactctggctgaaggccagaacgttgagttcgaaattcaggacggccagaaaggt
ccggctgctgttaacgtaacagctatctga

DBGET integrated database retrieval system