KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_10015Help
Entry
I137_10015        CDS       T02790                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00010  Glycolysis / Gluconeogenesis
seep00260  Glycine, serine and threonine metabolism
seep00680  Methane metabolism
seep01100  Metabolic pathways
seep01110  Biosynthesis of secondary metabolites
seep01120  Microbial metabolism in diverse environments
seep01130  Biosynthesis of antibiotics
seep01200  Carbon metabolism
seep01230  Biosynthesis of amino acids
Module
seep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seep_M00002  Glycolysis, core module involving three-carbon compounds
seep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:seep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I137_10015 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    I137_10015 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I137_10015 (gpmA)
Enzymes [BR:seep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     I137_10015 (gpmA)
Membrane trafficking [BR:seep04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    I137_10015 (gpmA)
Exosome [BR:seep04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   I137_10015 (gpmA)
  Exosomal proteins of melanoma cells
   I137_10015 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGS63442
LinkDB All DBs
Position
2173501..2174253
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaagcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaacaaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system