KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_10180Help
Entry
I137_10180        CDS       T02790                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00020  Citrate cycle (TCA cycle)
seep00190  Oxidative phosphorylation
seep00650  Butanoate metabolism
seep01100  Metabolic pathways
seep01110  Biosynthesis of secondary metabolites
seep01120  Microbial metabolism in diverse environments
seep01130  Biosynthesis of antibiotics
seep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:seep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I137_10180 (sdhB)
   00650 Butanoate metabolism
    I137_10180 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I137_10180 (sdhB)
Enzymes [BR:seep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I137_10180 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     I137_10180 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AGS63467
LinkDB All DBs
Position
complement(2208591..2209310)
Genome map
AA seq 239 aa AA seqDB search
MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGV
CGSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKP
YLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAY
RFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgt
atgcaggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgtta
atccagcttaaagaaaaagatcccagcctttctttccgtcgttcctgccgcgaaggtgtg
tgcggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatt
tcggcgctgactcagccgggtaagaagattgtgattcgcccgctgcccggtttgccggtg
atccgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagcct
tacttattgaataatgggcaaaatccaccggctcgtgagcatctgcagatgccggagcag
cgtgaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgc
ccgtcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtat
cgattcctgatcgatagtcgtgataccgagaccgacagtcgtctggaagggatgagcgat
gcattcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaaggga
ctaaacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcataa

DBGET integrated database retrieval system