KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_10750Help
Entry
I137_10750        CDS       T02790                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Brite
KEGG Orthology (KO) [BR:seep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I137_10750
Enzymes [BR:seep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     I137_10750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA Glutaredoxin K_oxygenase HI0933_like FMO-like
Motif
Other DBs
NCBI-ProteinID: AGS63546
LinkDB All DBs
Structure
PDB: 

Position
complement(2324123..2325670)
Genome map
AA seq 515 aa AA seqDB search
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAGEGIRTGLMGERFG
GQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAAEGGLHQIE
TASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNS
GVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGDGSKVVG
LEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSVKGVFAA
GDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcagggcttaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcggaaatcaaggaactgctg
gctgaaatcgccgagctgtccgacaaagtcacgtttaaagaagacaatactctgccggtg
cgcaagccgtctttcctgattacgaatccaggttctcagcaagggccgcgctttgccggt
tctccgctgggccacgaatttacctcgctggttttggcgctgctgtggaccggcggtcat
ccgtcaaaagaagcgcagtcgctgctggagcagattcgcgatattgacggcgattttgaa
ttcgaaacttattattcactttcctgccataactgcccggacgtagtgcaggcgctgaac
ctgatggcggtgctgaacccgcgtattaaacatacggcaattgatggcggcaccttccag
aacgaaatcaccgagcgtaacgtgatgggcgttccggcggtgtttgtcaacggtaaagag
ttcggccagggacgtatgactctgaccgagattgtcgctaaagtggatactggcgcagaa
aaacgtgcggcggaagcgctgaacaaacgcgatgcgtatgacgtgctgattgtcggttcc
ggcccggcgggcgcggcgggggaaggcatccgtaccggtctgatgggcgagcgcttcggc
ggtcaggtgctggataccgtggatatcgaaaactatatctcggtgccgaaaaccgaaggc
cagaaactggcgggcgcgctgaaagcgcatgtcagcgattacgacgttgacgttatcgac
agccagagcgcaagtaaactggttccggcagcggcagaaggcggcctgcatcagattgaa
acggcgtccggcgcagtcttgaaagcgcgcagtatcatcatcgccaccggcgcgaaatgg
cgcaatatgaatgtgccgggcgaggatcagtatcgcaccaaaggcgtcacctattgtccg
cactgcgacggtccgttatttaaagggaagcgtgtggcggtcatcggcggcggcaactct
ggcgttgaagcggctatcgatctggcaggtattgtagaacacgttacgttgctggagttc
gcgccggagatgaaggcggatcaggtgctacaggacaaagtgcgtagcctgaaaaatgtc
gatatcattttgaatgcgcaaacgacagaagtgaagggcgacggttcgaaagtggtgggg
ctggagtatcgtgaccgtgtcagcggcgatattcatagcgtcgcgctggcagggattttt
gtgcagattggtctgttgccgaatacccactggctggaaggcgcgcttgagcgtaaccgc
atgggcgagatcattattgacgccaaatgtgaaaccagcgttaagggcgtcttcgctgca
ggcgattgcaccaccgttccttacaaacagattatcatcgccacaggcgaaggggcgaaa
gcctcgttgagcgcctttgattatctgattcgtaccaaaatcgcataa

DBGET integrated database retrieval system