KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_19360Help
Entry
I137_19360        CDS       T02790                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
seep00290  Valine, leucine and isoleucine biosynthesis
seep00770  Pantothenate and CoA biosynthesis
seep01100  Metabolic pathways
seep01110  Biosynthesis of secondary metabolites
seep01130  Biosynthesis of antibiotics
seep01210  2-Oxocarboxylic acid metabolism
seep01230  Biosynthesis of amino acids
Module
seep_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
seep_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:seep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    I137_19360
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    I137_19360
Enzymes [BR:seep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     I137_19360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AGS65907
LinkDB All DBs
Position
complement(4147406..4149136)
Genome map
AA seq 576 aa AA seqDB search
MSQKCQHARDLWSQLDALRLGMNYSKEDVNKLQVLVDDCYGESHPGSFHLNQLGDEAVLG
VHESGGRAVRHHVTDICDGWGQGHDGMNYILASREAIANMVEIHASVVPYDAGILISSCD
KSIPAHLIAAARLNLPLLHIPGGSMRPAPNMSTSDLGGITAKLKKGEIGIQQVEAMQQCG
CPTAGACQFMGTASTMQCMSEALGLTLPGSALLPSTLAEIRRVARTAGHQALYLAEKNIT
THKILTPAAFENAIKVHAAIGGSTNAMIHLPAIAHELGWELKPELFDRINNEIPYLTNIQ
PSGEYVTEMMWFAGGVPMVQWYLRDYLDLDVLTVTGRTLGDNLEMLHQSGFFTRNHGYLN
NYKVSPEEVIRKPENATKKGSIAVLKGNIAPEGAVIKYAACAPDMHHHTGPARVFNSEED
AQQAIIHNHIEPGDVIFIRYEGAKGSGAPEMLMTTDAIVYDKRLDGKVALITDGRFSGAT
SGPCVGHVSPEAADGGPIALVEDGDLIEMDVKGRKLNIVGIDGVFKTEEEIRRCLEERRA
SWKKPDYSNRHGVSKQFTANATSLMAGAWLKAPRLF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaaatgtcaacatgctcgcgacctgtggtcgcagctcgacgccctgcgtctt
ggaatgaattacagcaaagaagatgtcaataaactgcaggtcctggtggatgattgctat
ggcgaaagtcatccgggcagtttccatcttaaccaactgggcgatgaagccgtgctgggt
gttcatgaaagcggcgggcgcgcggtccgtcaccatgtgacggatatctgcgacggctgg
ggtcagggccacgatgggatgaactacatcctggcatctcgcgaagccattgccaacatg
gtcgaaattcatgcctcagtggtgccttatgatgccggtattctgatctcaagctgcgat
aaatctatcccggcgcatctgattgccgccgcacgcctgaacctgccgctgctgcatatt
cccggcggttctatgcgtccggcaccgaatatgagtacttctgacctcggcgggatcact
gctaagttgaagaaaggcgaaatcggcattcagcaagtagaagccatgcagcaatgcggt
tgccccaccgccggagcctgccagtttatgggaacggccagtaccatgcagtgcatgtca
gaggccttggggctgaccctgccaggcagcgctttgctgccatcgaccctggcggaaatt
cgccgcgttgccagaaccgcaggccaccaggcgctgtatctggcggagaaaaatatcacc
acccataagatcctgactcctgcggcgtttgaaaatgctatcaaagtccatgctgctatt
ggtggcagcaccaatgcgatgatccaccttccggccatcgctcatgaacttggatgggag
ctgaagcccgaactgtttgatcggatcaataacgaaatcccttatctgaccaatattcag
cccagcggtgaatacgttaccgaaatgatgtggttcgctggcggcgtgccaatggtgcaa
tggtatctgcgcgattatctggatcttgatgttcttaccgtgactggccgtacgctcggc
gacaacctggaaatgctccatcaatctggcttctttacccgtaaccacggttacctcaac
aattacaaagtcagtccggaggaggtgatccgtaaaccagaaaatgccaccaaaaaaggg
tcgattgcggtactgaaaggcaacatcgcgcctgaaggagcggtcattaaatacgcggcc
tgtgcgccggatatgcaccaccataccggtcctgctcgggtctttaactccgaagaagac
gctcagcaggccatcatccataaccatatcgaacccggcgacgtcattttcattcgctac
gaaggcgcaaaaggctctggcgcaccggaaatgctgatgaccaccgatgccatcgtgtat
gacaaacgcctcgacggaaaagtcgcattgattaccgacggtcgtttctctggagcgacc
agcgggccatgtgtcggacacgtctcgccagaagccgctgatggcgggccgattgccctg
gtggaagatggtgatttaatcgaaatggatgtgaaaggccgcaagctcaatattgtaggg
atcgacggggtgtttaaaacagaagaggaaatacgccgctgccttgaagagcgtcgagca
agctggaagaaacctgattattcaaaccgtcacggcgtctctaaacagttcaccgctaat
gcaacatcattaatggccggagcctggcttaaagcgcctcgcctgttttaa

DBGET integrated database retrieval system