KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0135Help
Entry
UMN798_0135       CDS       T01782                                 

Gene name
ftsI
Definition
(GenBank) penicillin-binding protein 3 precursor
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00550  Peptidoglycan biosynthesis
sef01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UMN798_0135 (ftsI)
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    UMN798_0135 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sef01011]
    UMN798_0135 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sef03036]
    UMN798_0135 (ftsI)
Enzymes [BR:sef01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     UMN798_0135 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:sef01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   UMN798_0135 (ftsI)
Chromosome and associated proteins [BR:sef03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    UMN798_0135 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AFD57168
LinkDB All DBs
Position
141728..143494
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWLQIIAPDMLVRQGDMR
SLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALSTALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLAGTPKDAMRNRTIT
DVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERIFPESTVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcaaaaacgcaaaaatcgaaacgccaggaagaacagaccaacttcatc
agttggcgttttgcgttgctgtgcggctgtattttactggcgctggtttttttacttgga
cgcgcggcgtggctacagattatcgccccggatatgctggtgcgtcagggcgatatgcgt
tcgctgcgtgttcaggaagtctccacctcacgcggtatgattaccgaccgttccgggcgt
ccactggcggtcagcgtaccggttaaggcgatctgggccgacccgaaagaagttcatgac
gccggcggcatcagcgttggcgatcgctggaaagcgctttctactgcgctcaatattcca
ctcgatcagctctccgcccgtatcaacgccaacccgaaagggcgttttatttatctggcg
cgccaggtaaatcctgacatggcggactacatcaaaaaactcaaactgccggggattcat
ttgcgtgaagagtcccgccgctactacccgtcaggagaagtaaccgctcacctcatcggt
tttaccaacgtcgacagtcaggggattgaaggcgttgaaaagagctttgataagtggctt
accggtcagcctggcgagcgaatcgtgcgtaaagaccgctatggccgcgtgattgaggat
atctcctccactgacagtcaggcagcgcacaatctggcgttaagcattgatgaacgctta
caggcgctggtttaccgcgaactgaacaacgcggtggcgtttaacaaggcggaatccggt
agcgcggtgctggtcgatgtcaataccggtgaagtactggcgatggcgaatagcccttcc
tataaccccaacaaccttgccggtacgccgaaagacgcgatgcgtaaccgtaccatcacc
gacgtgtttgaaccgggttctacggttaagccgatggtggtgatgactgcgcttcagcgc
ggtatcgtcaacgaaaatacggtgttgaataccgttccataccgaattaacggccacgaa
attaaagacgtggcgcgctacagcgaattaaccctgaccggggttctacagaagtcgagt
aacgtcggtgtatccaaactggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttgggctaggaaaggcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtccgacatagagagggccaccttctctttcggctacggg
ctaatggtaacgccgttacagttagcgcgagtctatgcaaccatcggcagctatggcatt
tatcgcccgctgtcgattaccaaagttgatccgcctgtacccggcgaacgcatcttccct
gaatccaccgtacgcaccgtggtgcatatgatggaaagcgtggcgctgccgggcggcggc
ggcgtgaaggcagcgattaaaggctaccgtatcgcgattaaaaccggtacggcgaaaaaa
gtggggccggacggtcgctacatcaacaaatacattgcttacaccgcaggcgtcgcgcct
gcgagtcagccgcgcttcgcgctggtggttgtcatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtatttggtgccatcatgggcggcgttctgcgcacc
atgaacatcgaaccggacgcgctggcaacgggcgaaaaaaatgaattcgtaattaatcaa
ggcgagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system