KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0300
Entry
UMN798_0300       CDS       T01782                                 

Gene name
sciK
Definition
(GenBank) SPI-6 associated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sef00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    UMN798_0300 (sciK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sef02044]
    UMN798_0300 (sciK)
Secretion system [BR:sef02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UMN798_0300 (sciK)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFD57316
LinkDB
Structure
PDB: 
5XHH

Position
316867..317352
AA seq 161 aa
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcttatgacatttttttgaaaattgacggcattgatggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcaccaacctggattttgatcac
tatatcgaccgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtggagctctccttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggcggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system