KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0837Help
Entry
UMN798_0837       CDS       T01782                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00010  Glycolysis / Gluconeogenesis
sef00260  Glycine, serine and threonine metabolism
sef00680  Methane metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01120  Microbial metabolism in diverse environments
sef01130  Biosynthesis of antibiotics
sef01200  Carbon metabolism
sef01230  Biosynthesis of amino acids
Module
sef_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sef_M00002  Glycolysis, core module involving three-carbon compounds
sef_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN798_0837 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    UMN798_0837 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMN798_0837 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sef04131]
    UMN798_0837 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sef04147]
    UMN798_0837 (gpmA)
Enzymes [BR:sef01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     UMN798_0837 (gpmA)
Membrane trafficking [BR:sef04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    UMN798_0837 (gpmA)
Exosome [BR:sef04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   UMN798_0837 (gpmA)
  Exosomal proteins of melanoma cells
   UMN798_0837 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFD57779
LinkDB All DBs
Position
complement(835605..836357)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system