KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_1108Help
Entry
UMN798_1108       CDS       T01782                                 

Gene name
fabA
Definition
(GenBank) D-3-hydroxydecanoyl-(acyl carrier-protein)
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00061  Fatty acid biosynthesis
sef01100  Metabolic pathways
sef01212  Fatty acid metabolism
Module
sef_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    UMN798_1108 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sef01004]
    UMN798_1108 (fabA)
Enzymes [BR:sef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     UMN798_1108 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     UMN798_1108 (fabA)
Lipid biosynthesis proteins [BR:sef01004]
 Fatty acid synthase
  Component type
   UMN798_1108 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AFD58021
LinkDB All DBs
Position
complement(1114487..1115005)
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TARKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTAHDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagaccttcttgcctctggtcgtggtgaa
ctgtttggcgctaaagggccgcaactccctgcaccgaacatgctgatgatggaccgcgtc
gttaagatgaccgaaacgggcggcaatttcgacaaaggctatgtcgaagccgagctggat
atcaatccggatctatggttcttcggatgccactttatcggcgatccggtgatgcccggt
tgtctgggtctggatgctatgtggcaattggtgggattctacctgggctggttgggcggc
gaaggcaaaggccgcgctctgggcgtgggcgaagtgaaatttaccggccaggttctgccg
acagccaggaaagtcacctatcgtattcatttcaaacgtatcgtaaaccgtcgcctgatc
atgggcctggcggacggtgaggttctggtggatggtcgtctgatctataccgcacacgat
ttgaaagtcggtttgttccaggatacttccgcgttctaa

DBGET integrated database retrieval system