KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_2465Help
Entry
UMN798_2465       CDS       T01782                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00564  Glycerophospholipid metabolism
sef01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UMN798_2465 (glpA)
Enzymes [BR:sef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     UMN798_2465 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 DAO_C Pyr_redox_2 FAD_oxidored 3HCDH_N NAD_binding_8 SO_alpha_A3 FtsA HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AFD59209
LinkDB All DBs
Position
2387346..2388944
Genome map
AA seq 532 aa AA seqDB search
MIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARYAVTDAESARE
CISENQILKRIARHCVEPTDGLFITLPEDDLAFQATFIRACEAAGIRAEAIDPQQARIIE
PSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIREGATVCGVHVR
NHLTGETQTLHAPVVVNAAGIWGQQIAEYADLSIRMFPAKGSLLIMDHRINQHVINRCRK
PSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAPVMAKTRILRA
YSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLDGFITITGGKLMTYRLMAEWATDAVC
RKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTPGWLSEGRQHR
SLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAAGLLQRFNVTT
AAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQDEI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgattatcattggcggtggagcaacaggcgcagggatcgcccgcgactgcgcgctgcgc
ggtttacgtgtcattctggtggagcggcatgatatagcgaccggcgcgaccgggcgtaac
cacgggctgctgcacagcggcgctcgttatgcggttaccgacgcggaatccgcgcgcgag
tgcattagtgaaaaccagattttaaaacggatcgcccgccattgcgtcgaaccgacggat
ggtctgtttattacgttgccggaagatgatcttgcgtttcaggccacctttattcgcgcc
tgtgaagcggcaggcattcgcgctgaagccatcgatccgcagcaggctcgcatcatcgaa
ccttccgttaaccctgcgctcatcggtgcggtaaaagtgccggatggcaccgtggaccct
ttccgccttaccgccgccaatatgttggatgccagagaacatggcgcaatcgtgttaacg
gcgcatgaagtgaccgggctcattcgtgaaggcgcaacggtctgcggcgtccatgtgcgc
aaccatctcactggcgaaactcagacgcttcacgcgccggtggtggtcaatgcggcaggt
atctgggggcaacagatcgccgaatacgccgacctgagtattcgcatgttcccggcgaaa
ggctcgctgttgatcatggaccatcggatcaaccagcatgtcattaaccgctgccggaaa
ccatcggatgccgacattctggtacctggcgatacgatttcactgatcggcaccacctct
acccatattgattacaatgagatagacagcaaccgcgtcaccgcagatgaagtcgatatc
ctgctgcgtgaaggggaaaaactggcccctgtcatggcgaagacgcgtattctgcgcgcg
tattccggcgtccgcccgctggtggccagcgatgacgatcccagcggtcgtaacgtcagc
cgcggtattgtgttgttcgaccacgccgaacgcgacgggcttgatggcttcattaccatt
accggcgggaagctaatgacttaccgcctgatggcggaatgggcgaccgatgccgtgtgc
cgcaagttgggcaatactcgcccctgcatcacggcggatacgccgttgcctggctcaaaa
gagtctacggaacatacgctgaaacgcattatctcgcttcccgcgccgctacgcggatcg
gcggtttatcggcatggcgatcgcacgccggggtggctgagtgaaggccgccaacaccgt
agcctggtctgtgaatgcgaggccgtcacggcgggggaagtgcagtatgccgtcgaaaac
ttaaccgtgaatagcctgctggatctgcgccgtcgcacccgcgtagggatgggcacttgc
cagggcgaactgtgcgcctgccgcgcggccgggctattgcagcgttttaatgtgacgacc
gcggcgcaatctattacgcaactctctgaatttctgaatgagcgctggaaaggcgtacaa
cctgtcgcctggggagacgcgctgcgcgaaagcgaattcacgcgctgggtttatcaggga
ttatgcggtctggagaaggagcaccaggatgaaatttga

DBGET integrated database retrieval system