KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_3032Help
Entry
UMN798_3032       CDS       T01782                                 

Gene name
gabP
Definition
(GenBank) GabA permease (4-amino butyrate transport carrier)
  KO
K11735  GABA permease
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Brite
KEGG Orthology (KO) [BR:sef00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sef02000]
    UMN798_3032 (gabP)
Transporters [BR:sef02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   UMN798_3032 (gabP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: AFD59697
LinkDB All DBs
Position
2964326..2965726
Genome map
AA seq 466 aa AA seqDB search
MGQLSESHALGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGPWAGYTIGWLYWWFWVLVIPLEANIAAIILNSW
IPGIPVWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIALGATAISGFYPY
AEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKSVGSYRSVLELLHIPHAKFIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAIMGKTNRSKTPWVAVLLSTGAAFLTVIVNYYAPAKVF
KFLIDSSGAIALLVYLVIAISQLRMRKILLAQGGEIKLKMWLYPWLTWLVIGFICFVLVV
MLFRPAQQLEVISTGLLGLGIIGTVPIMSRWKKLIRWQKAPLQNLR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaattgtcagaatcacatgcattagggggcgggctgaaatcacgccacgtcacc
atgttatcgatcgccggcgtcatcggcgccagcctgtttgtcggttccagcgtggcgatt
gcggaggccggccctgcggtactgctggcctatctgttcgcaggacttttagtcgtcatg
attatgcgaatgctggctgaaatggccgtcgccacaccggataccggatctttttccacc
tatgcggataaagcgatcggcccctgggccgggtataccatcggctggttatactggtgg
ttttgggtgctggttattccgctggaggccaatattgccgccattattctgaattcatgg
ataccgggtattccggtatggctattttcattagtgattacgcttgccttaaccggaagc
aatttattgagcgtcaaaaattacggcgagttcgaattctggctggcgctatgtaaagta
attgccattctggcgtttatcgcgctgggcgcgacggcgattagcggtttttatccgtat
gctgaggtaagcggtatctcccggctctgggatcacggcggttttatgcctaacggcttc
ggcgcggtgttaagcgccatgttgatcaccatgttctcttttatgggcgcggaaatcgtt
actattgctgccgcggaatccgatacgccggataaacatatcgtacgcgccaccaattct
gttatctggcgaatttccatcttttacctgtgttccatttttgtggtggtggcgctgatc
ccgtggaatatgccgggtctgaaaagcgtaggttcgtaccgttcggtactggagctgctt
catattccgcacgcaaaattcattatggactgcgtgattttattgtcggtgaccagttgt
ctgaactccgcattatataccgcctcccggatgctctattcccttagccgccgcggcgat
gctcctgcgataatgggaaaaactaaccgtagcaaaacgccctgggtagcggttctcctc
tctaccggcgcggcctttttaaccgttatcgtcaattattacgccccggcaaaagtgttt
aaatttcttatcgacagttccggcgccatcgcgctgctggtctatctggtgattgcgatt
tcgcaattgcgaatgcgtaaaattctgctggcgcagggcggagaaattaagctgaaaatg
tggctttatccgtggctcacctggctggttatcggctttatctgctttgtcctggtggtg
atgctatttcgaccggcacagcaactagaagtcatttcaacggggctgttagggctgggc
ataataggtactgtccccattatgtctcgctggaaaaaactgataaggtggcaaaaagcc
cccctgcaaaacctacgttag

DBGET integrated database retrieval system