KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG0644Help
Entry
SG0644            CDS       T00770                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00550  Peptidoglycan biosynthesis
seg01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:seg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SG0644 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SG0644 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:seg01011]
    SG0644 (mrdA)
Enzymes [BR:seg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SG0644 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:seg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SG0644 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CAR36540
UniProt: B5R7Y8
LinkDB All DBs
Position
complement(692340..694241)
Genome map
AA seq 633 aa AA seqDB search
MKRQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQILRFTDYQTRSNENRIK
LVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDALRSVVDLNDDDIAAFK
KERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVS
KINDKDVERLDRENKLANYAATHDIGKLGIERYYEDILHGQTGYEEVEVNNRGRVIRQLK
EVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVIVTDPRTGGVLSLVSMPSYDPNLFVDG
ISSKDYSGLLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTSLFDPGWWQL
PGSEKRYRDWKKWGHGHLNITKSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGID
LAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGVVKV
PHLLMSTAENGKQVPWVQPHEPPVGDIHSGYWEIAKDGMYGVANRPNGTAHKYFASAPYK
IAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYNNPQVAVAIILENGGAGPAV
GTIMRQILDHIMLGDNNTHLPAENPVVAAAEDQ
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacaaaattcttttcgtgactatacggctgagtccgcactgtttgtgcgtcgg
gcgctggtcgcctttttgggtattttgctgctgaccggcgtactgatcgccaatttgtat
aatctgcaaatccttcgttttaccgattaccagacccgctcgaacgaaaaccgtatcaag
ctggtgccaattgcgccaagccgcgggataatctacgaccgtaacggcattccccttgcg
ctgaaccgcactatctatcagattgaaatgatgccggaaaaggtggataacgttcagcaa
acgctggatgcgctacgcagtgtggtcgatttaaacgacgacgatatcgccgcctttaaa
aaagagcgcgcccgatcccatcgctttacttctattccggtgaaaacaaacctgacggaa
gttcaggtcgcgcgctttgccgtcaaccagtaccgttttccgggcgtcgaagtcaaaggc
tataaacgccgctattatccatacggatcggcgctgacccacgttatcggctacgtatcg
aaaatcaatgataaagacgtcgagcgtctcgacagagaaaacaaactggcgaactacgcc
gccacccatgacatcggcaagctgggcattgagcgctactatgaagatattctgcatggg
caaaccggttatgaagaggttgaagtcaacaaccgcggtcgcgttattcgccaactcaaa
gaggtgccgccgcaggccggacacgatatctacctgacgctggatctcaagctccagcag
tatattgaaacgctgctggcaggcagtcgcgcggcggtgattgtcaccgatccgcgtacc
ggcggcgtgctatcgctggtctccatgccaagttacgaccctaaccttttcgtggatggc
atctccagcaaagattattccgggctgcttaacgacccgaacacgccattagtgaaccgc
gcgactcagggtgtctacccacctgcttctaccgttaagccttacgtcgccgtatcggcg
ttaagcgctggcgtcatcacccgtaacaccagtcttttcgaccctggctggtggcagttg
ccggggtctgagaaacgttatcgcgactggaaaaaatggggccacgggcatctgaatatc
accaaatcccttgaagagtcggcggataccttcttctatcaggttgcctatgatatgggg
atcgatcgcctgtcagaatggatgggtaagttcggctatggtcactacaccggaattgat
ctcgcagaagagcgctctggtaatatgccgacccgcgagtggaaacagaaacgctttaaa
aaaccgtggtatcagggcgatacgattccggtgggcatcggccagggttactggacagcg
acgccgattcagatgagtaaggcgctgatgatccttattaacgacggtgtagttaaagtc
ccgcacctgttaatgagcaccgcggaaaacggtaaacaggtgccgtgggtacagccgcat
gagccgccggtgggcgatattcactccggctactgggaaattgcgaaagatggcatgtat
ggcgtcgccaaccgccctaacggcacagcgcataaatattttgccagcgcgccctataaa
atcgcggcgaagtcgggcaccgcgcaggtctttggcctgaaggccaacgaaacgtacaat
gcgcataaaatcgccgagcgcctgcgcgaccataaattaatgaccgcctttgcgccgtat
aacaatccccaggtcgccgtcgcgatcatccttgaaaacggcggtgcaggcccggcagta
ggcacaatcatgcgccaaatccttgatcacatcatgctgggcgacaacaacacccatttg
cctgcggaaaacccggtggttgcagcggcggaggaccaataa

DBGET integrated database retrieval system