KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG0899Help
Entry
SG0899            CDS       T00770                                 

Gene name
cydC
Definition
(GenBank) transport ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:seg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SG0899 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:seg02000]
    SG0899 (cydC)
Transporters [BR:seg02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    SG0899 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N AAA_16 DUF87 AAA_22 NACHT FtsK_SpoIIIE MMR_HSR1 FliP AAA_29 AAA_30 RsgA_GTPase Rad17 AAA_23 NB-ARC
Motif
Other DBs
NCBI-ProteinID: CAR36789
UniProt: B5R8H4
LinkDB All DBs
Position
complement(964615..966336)
Genome map
AA seq 573 aa AA seqDB search
MRALLPYLTLYKRHKWMLTLGIALAILTLLASIGLLTLSGWFLSASAIAGFAGIYSFNYM
LPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYQQGELL
NRIVADVDTLDHLYLRVISPLVGAFVVIMIVTLGLSVLDVTLAITLGGIMLLTLFIMPPV
FYRAGKNTGQNLTHLRGQYRQQLTSWLQGQAELTIFGASKRYRAQMEATELQWHEAQRRQ
SELTALSQALMLLIGALAVMLMLWMASGGVGGNTQPGALIALFVFCALAAFEALAPVTGA
FQHLGQVIASALRITELTEQKPEVTFPQSETPAPEKVTLTLRDVSFRYPDQPINALNALS
LQANPGEHVAILGRTGCGKSTLLQLLTRAWDPQQGEILLNDLPLSSLSESALRRTISVVP
QRVHLFSATLRDNLLLAAPNASDEALSDMLRHVGLENLLEDSGLNSWLGEGGRLLSGGEL
RRLAIARALLHDAPLMLLDEPTEGLDATTESEMLELLADVMREKTVLMVTHRLRGLARFD
QIIVMDDGRIIERGTHAELLAGQGRYYQFKQRL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctactcccttatctgacgctttataaacgccataaatggatgctaacgctg
ggaattgcgctggcaatcctgaccctgcttgccagtatcgggctgctgacgctttccggc
tggttcctgtccgcgtccgctatcgcaggcttcgcgggaatttacagttttaactatatg
ctcccggcagccggcgtgcgcggcgcggccattacccgtaccgctggtcgttattttgaa
cgtctggtaagtcatgacgccacgttccgcgtgctgcaacatctgcgtatttataccttt
agcaaacttttaccgctctcccccgcgggtctggcgcgatatcagcaaggtgaactgctg
aaccgcatcgttgccgacgttgacacgctggatcatctctatttgcgcgtcatctccccg
ctggtcggcgcttttgtagtgattatgattgtcaccctggggcttagcgttctcgacgtg
acgctggcgatcacgctgggcggcattatgctgttgacgctgtttattatgccgccggtg
ttttatcgcgccggcaaaaataccggccaaaatctgacgcatctacgcggtcagtatcgc
cagcagctcacgtcatggttacagggccaggcggaactcaccatttttggcgccagcaaa
cgctatcgggcgcaaatggaagccaccgaattacaatggcatgaggcccaacgccgacag
tctgaactcaccgccttatcgcaggcgttaatgctgctgattggtgcgctggcggtgatg
ttaatgttgtggatggcctccggcggcgttggcggcaatacgcagcccggcgcgctcatc
gcgctgtttgtcttctgcgcgctggcggctttcgaggcgcttgcgcccgttaccggcgca
ttccagcatctggggcaggttatcgcctctgcgcttcgtatcactgaattaacggagcaa
aaaccggaggtgacctttccgcaatcagaaactcccgcgccggaaaaggtcacactcacc
ctgcgggacgtttcgtttcgttatcccgaccagccgattaatgcgctcaatgccctctca
ttacaggctaatcctggcgagcatgtcgctattctggggcgtaccggctgcggaaaatca
acgctgttgcagctactcacccgcgcctgggacccgcaacaaggcgaaattctgctcaac
gatcttccgctatcctcgttgagcgaatccgccttacgccggactatcagcgtggtgccg
cagcgtgtccacctgttcagcgccacgctgcgtgataatttattactggcggcgcccaat
gccagcgacgaagccctttccgatatgctgcgtcacgtcggcctcgaaaatctgctcgaa
gatagtgggcttaatagctggctcggcgaaggcggtcgtctgctatccggcggcgaactt
cgtcgtctggccatcgcccgcgcgctgttgcatgatgctccgttaatgctgttggatgag
cccactgaggggctggatgcgaccaccgagagcgaaatgctggaattacttgccgatgtg
atgcgcgagaaaaccgtcctgatggtgacgcaccgtttgcgcggcctggcccgttttgat
caaatcatcgtaatggacgacgggcgcatcattgagcgaggcactcatgcagaattgtta
gccggacaagggcgctattatcagtttaaacaacgtctgtaa

DBGET integrated database retrieval system