KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1883Help
Entry
SG1883            CDS       T00770                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00020  Citrate cycle (TCA cycle)
seg00480  Glutathione metabolism
seg01100  Metabolic pathways
seg01110  Biosynthesis of secondary metabolites
seg01120  Microbial metabolism in diverse environments
seg01130  Biosynthesis of antibiotics
seg01200  Carbon metabolism
seg01210  2-Oxocarboxylic acid metabolism
seg01230  Biosynthesis of amino acids
Module
seg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:seg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG1883 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SG1883 (icdA)
Enzymes [BR:seg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SG1883 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: CAR37735
UniProt: B5RB64
LinkDB All DBs
Position
complement(1945835..1947085)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPVEGKKITLQNGKLNVPENPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLARDEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggtggaaggtaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgagaatccgattatcccgtttattgaaggcgatggtatcggtgttgat
gtcactccagccatgcttaaagtagtcgatgccgccgtcgagaaagcctataaaggcgag
cgtaaaatttcctggatggaaatttacaccggagaaaaatccacacaggtttacggccag
gatgtctggcttcccgctgaaacccttgatttaattcgtgactaccgcgtagcgattaaa
ggtccattgaccacgccggttggcggcggtatccgctctctgaacgttgccctgcgtcag
gagcttgacctgtacgtttgtctgcgtcccgttcgttactatcagggcacgccaagtccg
gtgaaacatccggagctgaccgatatggtcatcttccgtgaaaactctgaagacatctac
gccggaattgaatggaaagctgactctgcagacgctgagaaagtgatcaagttcctgcgc
gaagagatgggcgtgaagaaaattcgcttcccggagcactgcggtatcggtatcaaaccg
tgttctgaagaaggcactaaacgtctggttcgcgcggcgattgaatacgctattaccaac
gatcgcgattccgtcacgctggtacataaaggcaatatcatgaagttcaccgaaggcgcg
tttaaagactggggctaccagttggcgcgcgacgagttcggcggtgagcttattgacggc
ggtccgtggctgaaaattaagaacccgaacacgggtaaagagatcgtggttaaagacgtt
atcgccgatgcgttcctgcaacaaatcctgttgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggtgactatatttccgatgccctggcggctcaggttggcggtatc
ggtattgcaccgggtgcgaatatcggcgacgaatgcgcgttgtttgaagcgactcacggg
actgcgccgaaatatgcgggccaggataaagtcaacccaggctccattattctgtctgcg
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgttaaaggtatg
gaaggcgcgattgccgcgaagaccgtgacctatgactttgaacgcctgatggaaggcgct
aagctgctgaaatgtagtgagtttggtgacgcgattatcgcaaatatgtaa

DBGET integrated database retrieval system