KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3152
Entry
SG3152            CDS       T00770                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00052  Galactose metabolism
seg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SG3152
Enzymes [BR:seg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     SG3152
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 MTS ADH_zinc_N_2 TrkA_N 3HCDH_N 2-Hacid_dh_C Methyltransf_31 Shikimate_DH Methyltransf_11 PrmA UDPG_MGDP_dh_N Pyr_redox_2 Met_10 FAD_binding_2 CoA_binding ELFV_dehydrog Sacchrp_dh_NADP Pyr_redox XdhC_C Fer4_4
Other DBs
NCBI-ProteinID: CAR38951
UniProt: B5REL1
LinkDB
Position
3289618..3290661
AA seq 347 aa
MKSVVIHAEGDVRVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQQVLETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLTPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtgcgcgttgaagaacgtcccttacca
caactgcaagccgaggacgatgtgttggtcaaagtcgttagctcagggctttgcgggtcg
gatatcccgcgtattttcgcgcagggcgcccattattatcctattacgttaggccatgaa
ttcagcggctacgttgaatcctacggcacaggcgtaacggatatgcagcctggcgatgcc
gtcgcttgtgtcccgcttcttccctgctttcactgtccgcaatgcgaacgcggttacttt
tctttatgcaaacagtatcagtttgtaggatcgcgcagcgaaggcggtaatgcggaatat
gtggtggtcaaacgggccaatcttttccgcttgccgtctgatatgccgattgaagatggc
gcgtttatcgaaccaattaccgtgggcttacacgcctttcatctggcgcagggctgcgag
gggaaaaacgtaattatcgttggtgccgggacaattggcctgctggccttacagtgcgcg
cgggaactgggcgcgcgaagcgtaacggcgattgatatcaatccgcagaaactggaactt
gcgaaagcgctcggcgcaacgcatacctgtaatagccgggaaatgaccgccgacgacatc
cagaccgcgttgtccgacattcagtttgatcaacaggttctcgaaacggcaggaactccc
cagaccgtctcgctggctatcgatatcgccgggccgcgcgcgcaactggcgctggtgggg
acgttacatcacgatctcaccctgacaacgcgtacattcgggctaattttgcgtaaagag
ctcacgctcctcggcagttggatgaactactccgcgccatggccaggagaagaatgggaa
accgcagcgcgcctgttggctgaaaaacgtcttcaactgacccctctcattgcccatcgc
ggcgatgcggaaagctttgcagaagcagtcaaagcgcttaatggcgcgcccatgcagggc
aaaatcctacttcaactttcctga

DBGET integrated database retrieval system