KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3366Help
Entry
SG3366            CDS       T00770                                 

Gene name
sodA
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Brite
Enzymes [BR:seg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SG3366 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAR39159
UniProt: B5RFB6
LinkDB All DBs
Position
complement(3519587..3520207)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENFPEFADLPVEELITK
LDQVPADKKTVLRNNAGGHANHSFFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttatgatgcactggaaccgcacttcgat
aagcagacgatggagattcaccacaccaaacaccatcaaacctatgtcaacaacgctaac
gcggcgctggaaaactttccagagtttgctgacctgccggttgaagaactgattactaaa
ctggaccaggtgccagcggacaaaaaaaccgtgctgcgtaataacgcgggcggccacgct
aaccacagcttcttctggaaaggcctgaaaaaaggcaccaccctgcagggcgatctgaaa
gcggctatcgagcgtgacttcggttccgttgacaacttcaaagctgaattcgaaaaagca
gcagcaacccgtttcggctccggctgggcgtggctggtgctgaaaggcgacaaactggct
gtggtttctaccgcaaaccaggattccccgctgatgggtgaagccatttccggcgcttcc
ggcttcccgatcctgggtctggacgtgtgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system