KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_0439Help
Entry
SPUCDC_0439       CDS       T02824                                 

Gene name
cysA
Definition
(GenBank) sulfate transport ATP-binding protein CysA
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
sega00920  Sulfur metabolism
sega02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sega00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SPUCDC_0439 (cysA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SPUCDC_0439 (cysA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sega02000]
    SPUCDC_0439 (cysA)
Enzymes [BR:sega01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     SPUCDC_0439 (cysA)
Transporters [BR:sega02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    SPUCDC_0439 (cysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N TOBE_3 CysA_C_terminal AAA_16 NACHT RsgA_GTPase DLIC AAA_22 AAA_24 AAA AAA_28 AAA_29 TniB SbcCD_C AAA_30 AAA_23 AAA_18 NTPase_1 AAA_25 SRP54 AAA_5 TsaE AAA_14 AAA_33 cobW T2SSE NB-ARC RecA
Motif
Other DBs
NCBI-ProteinID: AGU63370
LinkDB All DBs
Position
491093..492190
Genome map
AA seq 365 aa AA seqDB search
MSIEIARIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQSSGHIR
FHGTDVSRLHARERKVGFVFQHYALFRHMTVFDNIAFGLTVLPRRDRPTAAAIKTKVMQL
LEMVQLAHLAYRFPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLR
QLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDRVWREPATRFVLEFMGEV
NRLTGTVRGGQFHVGAHRWPLGYTPAYQGPVDLFLRPWEVDISRRTSLDSPLPVQVIEAS
PKGHYTQLVVQPLGWYHDPLTVVMAGEDVPVRGERLFVGLQKARLYNGDQRIETREEELA
LAQSA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgagatcgccagaattaagaaatcgtttggtcgtactcaggtactaaatgat
atctcgctggatattccttccggccagatggttgccttgttggggccgtcaggttccggc
aaaacgacgctgctgcgcattattgccgggctggagcatcagtccagcggccatattcgt
ttccacggtacggacgttagccgcctgcacgcgcgtgagcgtaaagtcggttttgtgttt
cagcactatgcgctgtttcgccatatgacggtgtttgacaacattgcttttggcctgacg
gtgctgccgcgacgcgaccgtccaactgcggcggcgattaaaacgaaagtgatgcaatta
ctggagatggtgcaactggcgcacctcgcgtatcgcttccccgcccagctttccggcgga
caaaaacagcgtgtggcgctggcgcgcgcgcttgccgtagaaccgcaaattctactgctg
gatgaaccctttggcgcgctggatgcccaggtacgtaaagagttacgtcgctggttgcgc
cagctacatgaagaactgaaattcaccagcgtctttgtcacccacgatcaggaagaagcg
acggaagtggcggatcgggtggtggtgatgagtcagggcaatatcgaacaggctgatgcg
ccggatcgggtgtggcgtgaaccggcaacccgcttcgtactggagtttatgggcgaggtg
aaccgcctgacaggcaccgtccgcggcgggcagtttcacgttggcgcgcatcgctggccg
ctgggttatacgcccgcgtaccaggggccggtcgatctgttcctgcgtccgtgggaggtg
gatattagccgccgcaccagcctggattctccgctaccagtacaggtcattgaggccagc
ccgaaaggtcactatacacagctagtggtgcagccgctggggtggtatcacgatccgctg
acggtggtgatggcgggtgaggatgttccggttcgcggcgagcgtttgtttgttggactg
caaaaagcgcgtctgtataacggcgaccagcgtattgaaacgcgtgaagaggaacttgct
ctggcgcaatcggcctga

DBGET integrated database retrieval system