KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1434Help
Entry
SPUCDC_1434       CDS       T02824                                 

Definition
(GenBank) putative hexonate dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Brite
KEGG Orthology (KO) [BR:sega00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPUCDC_1434
Enzymes [BR:sega01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     SPUCDC_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH Methyltransf_25 ThiF Pyr_redox_2 AlaDh_PNT_C DapB_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGU64304
LinkDB All DBs
Position
1463601..1464644
Genome map
AA seq 347 aa AA seqDB search
MEKITCNSCLAHAEKDVRFESREIEHSEHDVVVKVACGGICGSDIHYYQHGRAGMSVLKH
PMVIGHEFVGVISKVPAGSDLKVGQTVAVNPSSPCNQCEMCLSGHQNLCGSMRFMGSAQF
NPHVNGGFSEYVVVKPEQCIPYDRRVPANVMAFSEPLAVAIHAVKKAGQLTGKRVLVIGA
GPIGCLILAAARSAGASELVASDLSPRCLELARQMGATAVMDPRDEEQVAHYQQHKGYFD
VVFEASGAPIAVASTVDFTRPAGTIVQVGMGASPVSWPVSTMLVKELNWVGSFRFIGEFI
TAVRWLEDGRVDPRPLISAEFPPQQIEDALITATDKNVSAKVLIRFD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataacctgtaactcttgtctggcccatgcggaaaaagacgtacgctttgaa
tcacgtgaaatagagcacagtgaacatgacgtcgtcgtgaaggtcgcctgcggcggcatc
tgtggctctgatattcactactatcagcatggccgcgcggggatgtctgtcctcaagcat
ccgatggtgattggccatgagtttgttggcgtgatcagcaaagtgccagcaggcagcgac
ctgaaagtgggccagacggttgcggtgaacccgtccagcccatgcaatcagtgcgagatg
tgcctttccggccatcaaaatctgtgcggctccatgcgctttatgggcagcgcgcagttc
aatccgcatgtgaatggcggtttttctgaatacgtggtggtaaaaccggagcaatgcatt
ccttacgacaggcgcgtgcccgcaaacgtgatggccttttcggagccgctggcggtcgcc
attcatgcagtaaaaaaggcaggccagttgaccggcaaacgcgtactggtgattggcgca
ggccccattggttgtctgatcctcgcggcggcgcgcagtgccggagcatctgaactggta
gcatccgatctcagcccacgctgtctggaactggcacgccaaatgggggccacagcggtg
atggatccgcgcgatgaagaacaggttgcccattatcagcagcataaaggctactttgat
gtcgtgtttgaggcctccggcgcgccgattgccgtggcatccaccgtcgacttcacccgc
cctgccggcaccatcgttcaggtggggatgggcgccagcccggtaagctggccggtgtca
acgatgctggttaaagaactcaactgggtcggctcattccgttttatcggtgagttcatc
accgcggtacgctggctggaagatgggcgcgtcgatcctcgcccgcttatcagcgccgag
ttcccgccccagcaaattgaagacgcgctgattaccgccacagacaaaaatgtctctgct
aaggtactcattcgtttcgattaa

DBGET integrated database retrieval system