KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_4572Help
Entry
SPUCDC_4572       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGU67287
LinkDB All DBs
Position
complement(4620446..4620760)
Genome map
AA seq 104 aa AA seqDB search
MKKSPLCCYLFCAAMSASSAALAATAPVSAGVIHFKGQIVEYGCNLAPHDRNIEVSCLRN
NIPHLQTVATPSGNAISLMNGIATVRHVSLKDHPEIQSLIVQYR
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaccattatgctgctacctgttttgtgcagcgatgtcagcttcatcagcc
gcgctggctgctaccgcgccggtctccgcaggcgttattcatttcaaaggccagattgtc
gaatatggttgtaatcttgcgcctcacgatcgcaatatcgaggtatcatgtttgcggaat
aatatcccccatttgcagacagtcgccacaccgtctggaaacgctatttcgttgatgaat
ggaatcgccacggtacggcacgtgtcgttaaaagatcatccggagattcaaagtctgatc
gtccagtaccgctaa

DBGET integrated database retrieval system