KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C0314
Entry
SeHA_C0314        CDS       T00738                                 

Definition
(GenBank) hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:seh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeHA_C0314
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seh02044]
    SeHA_C0314
Secretion system [BR:seh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeHA_C0314
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACF67933
UniProt: A0A6C6ZM03
LinkDB
Structure
PDB: 
5XHH

Position
324862..325347
AA seq 161 aa
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcttatgacatttttctgaaaattgacggcatcgacggtgagtcgatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatatccatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcaccaacctggattttgatcac
tatatcgaccgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtagagctttctttcagcactgtgaaacaggaatacgtggtgcagaac
cagcagggcggcagcggcggcactatcaccgcaggttacgatttcaaggcgaacaaagaa
atttaa

DBGET integrated database retrieval system