KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C1713
Entry
SeHA_C1713        CDS       T00738                                 

Definition
(GenBank) zinc-type alcohol dehydrogenase
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C TrkA_N Pyr_redox_2 Peptidase_M55 Pyr_redox_3 Pyr_redox FAD_binding_2 DAO
Other DBs
NCBI-ProteinID: ACF65894
UniProt: A0A6C6ZH30
LinkDB
Position
complement(1664446..1665471)
AA seq 341 aa
MKVKAVFINKPGEVETLWVDYPHKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQEGTGMPDNIKKGDRVIVDPYIYCGHCYPCSVGRTNCCENLNVIGVHVDGAM
QEVVTHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEYVAIIGAGAIGLMAA
LSARHYKATPILIDIVEERLRYAQKLGVPYVLNAADDQVIDAIKNITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETSLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKVVNLDEIPDAVKELDRYPERYLKINAVFH
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgttcattaataagcctggtgaagttgaaaccctctgggtggat
tatccccataagaaagaaaatgaagtattaattaaggttgatgccgcaggcatttgcgga
tcggatatcggggcttttcgtggaacgaacccactggttacttacccaagaattattggg
catgaagtgaccggaattgttcttcaggaaggtaccggaatgccggacaatattaaaaaa
ggcgaccgcgtgattgttgacccttatatttattgtggtcactgctacccttgctctgtc
ggcagaactaattgttgtgaaaatttaaacgtcattggcgtgcatgtcgatggcgcaatg
caggaggtggttactcatcctgcacatttaattcataaaataccagataatgtgccttct
gaaatggcgccgctggcagaaccgctgactatcgctctgcacgcgctgcatcgggcaaac
gttaaggccggggagtatgttgccatcatcggcgcgggggccattggtcttatggcggca
ttaagcgcgcgacattacaaggcaacgcctattctgatcgatattgtggaagaaaggtta
cgctatgcgcaaaagcttggcgttccttatgtgctgaacgccgctgacgatcaggttatc
gacgctattaaaaatatcacccacggcaccatggcgcaggtcgtgatagaagcctccggc
gcaaatagcgctattcgaaatacgcttgatttagcatcgtttgctggtcgtatttcgttt
accggatggccaaaacaggaaacgtcgctgccgacgaacctgatcacctacaaagaactg
gatttacgcggttcccgcaccagtgccggtgaatttgatgaggcattacgtatgctgtct
acgttggagattaatccgcaagatgttgtcagtaaggtcgtcaatcttgatgagatccct
gatgcagttaaagaacttgatcgctatccggagcgctacttaaagattaatgctgttttc
cattga

DBGET integrated database retrieval system