KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C1940Help
Entry
SeHA_C1940        CDS       T00738                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00240  Pyrimidine metabolism
seh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SeHA_C1940 (tdk)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SeHA_C1940 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: ACF65912
LinkDB All DBs
Position
complement(1893807..1894424)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNTSLFEEIRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQDGRPYNEGEQVVIGGNERYVS
VCRKHYKDALEEGSLTAIQERHRHI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattcggcaatgaatgcgggtaagtcgactgcactgctg
caatcttcatacaattatcaggaacgcgggatgcgtaccgtcgtatatacggcggaaatc
gacgatcgtttcggcgcaggcaaagtcagctctcgtatcggtttgtcgtcgccggcaaaa
ttgtttaaccaaaatacatccttgtttgaagagattcgtgccgagagcgcgcggcagaca
atacattgcgtgttagtcgacgaaagccagtttttgactcgccagcaggtttatcaatta
tccgaggttgtcgacaaattagatattccagtactttgctatgggctacgaacagacttt
cgtggggagctctttgtcggcagccaatacttgctggcatggtcagataagctggtggaa
ttaaaaactatctgtttctgcggtcgtaaagccagtatggttctgcgccttgatcaggac
ggcaggccttataacgaaggcgaacaggtggttattggcgggaatgaacgctacgtttca
gtttgccgtaagcattataaggacgcgctggaggagggctcactgacggcgattcaggag
cgtcatcggcacatatga

DBGET integrated database retrieval system