KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C2125Help
Entry
SeHA_C2125        CDS       T00738                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00550  Peptidoglycan biosynthesis
seh01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:seh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SeHA_C2125 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SeHA_C2125 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:seh01011]
    SeHA_C2125 (mrdA)
Enzymes [BR:seh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SeHA_C2125 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:seh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SeHA_C2125 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACF68443
LinkDB All DBs
Position
2052859..2054730
Genome map
AA seq 623 aa AA seqDB search
MTFKDFDAEEKLFLRRVIVAFGVVVVCFGILIFNLYNLQIRQHHYYTTRSNENDIKMLPV
APTRGIIYDRNGIPLVRNVTWYDIAVTPYKIADMDALLKQLTPIVDLSPDDIANFRRALK
SSSRYRPVVLKNALTDVEIARFAVNQFHFNGVTINSYQDRQYPYGAELAHVLGYVSKIND
NDLKALDKKGLAENYAADHNIGKQGIERYYENDLHGKTGYQEVEVDNHGRIVRLLKDVPP
IAGKNIHLTLDLHLQEYIESLLAGQRAAVLVEDPHDGSVLAMVSMPSYDPNPFVKGISYQ
DYGKLLHDKNLPLINRVTQGLYPPASTVKPYMAMSALLCGIITPQTTFFGAPTWTLPGTQ
RHYRDWKKTGHGMLDVTKAIEESADTFFYQVAYMMGIDRIDTMLSQFGYGKPTGIDLNEE
YDGLLPSRAWKQRVHKKAWYQGDTISVGIGQGYWIATPIQMVKAMVALINNGKVIAPHLL
LNEESGKTVVPYRPSGTPAQIADPASPYWGLVRQAMYGMANAPNGTGYKFFHTAPYGIAA
KSGTSQVFSLKENQTYNAKMIPIRLRDHVFYTAFAPYKNPKVAIALILENGGSDGVTAAP
IMRKILDHLFDPQADTTQPGQAP
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaagactttgatgcggaagagaaactcttcctgagacgtgtgattgtggcg
tttggtgtagtggttgtctgctttggtatcctgatcttcaacctctataacttacaaatc
cgccagcaccactactacaccacccgttcgaatgagaacgatatcaagatgctacccgtc
gcgcccacgcgcggcatcatttacgatcgcaacggcattccgctggtgcgtaacgtaacc
tggtatgatatcgcggttacgccctataaaattgccgatatggatgcgctgctaaaacag
ctcacccctattgttgatctctcccccgacgatatcgccaactttcgccgcgcgctaaaa
tccagtagccgctatcgtccggtagtgctcaaaaacgcgctaacggatgttgaaatcgca
cgctttgcggtcaatcagtttcatttcaacggcgtcacgatcaatagctatcaggatcgg
cagtatccttacggcgcggagctggcgcatgttctcggttacgtgtcaaagataaacgat
aacgaccttaaagcgctggataaaaaagggctggcagagaattacgcggcggaccataac
atcggtaaacaggggattgagcgttactacgaaaacgatcttcatggcaaaaccggttat
caggaggtcgaggtggataatcacgggcgtattgtccgcctgctgaaagacgttcctccc
atcgcgggtaagaacattcacctgacgctggatctccatttacaagagtacattgaaagt
ttgctggccgggcagcgtgctgccgtactggttgaagatccgcacgatggttcagtgctg
gcgatggtatctatgcccagctacgacccgaacccctttgtaaaaggcattagctatcag
gattacggcaaactgctgcacgataaaaatctgccgctgatcaaccgcgtgacgcaaggg
ctttatcccccggcgtcaacggttaaaccctatatggcgatgtccgcgctgttatgcggg
attattacgccgcaaaccaccttctttggcgcgccaacctggacgcttcccggcacgcag
cgtcattaccgggactggaaaaaaaccggacacggtatgctggatgtcactaaagcgatt
gaggaatctgcggatacctttttctatcaggtcgcttatatgatgggtattgaccgtatc
gacacgatgttgtctcagttcggctatggcaaaccgacgggcatcgaccttaatgaagag
tatgacgggctgcttcccagccgcgcatggaaacagcgggtccataaaaaagcctggtat
cagggcgataccatctctgtcggcatcggccagggttactggattgccacccccatccag
atggtaaaagcgatggtggcgctcatcaacaacggtaaggtgattgcccctcacctgtta
ctcaatgaagagagcggcaaaacggtggttccgtatcgtccttcaggaacaccggcacag
atagccgatccggcgtcgccatactggggactggtgcgtcaggcgatgtatggcatggcg
aatgcacccaacggaacgggctataagttctttcacaccgcgccctacggcattgcggcc
aaaagcggcacgtcgcaggtatttagcctgaaagaaaatcagacctacaacgcgaaaatg
atccccattcgcctgcgcgatcatgtgttttataccgcttttgcaccgtataaaaaccct
aaggtcgctattgccttgattctggaaaacggcggaagcgacggcgttaccgccgcgccc
atcatgcgaaaaatccttgaccacctgtttgatccacaggctgataccacgcagccgggt
caggcgccatag

DBGET integrated database retrieval system