KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C2971Help
Entry
SeHA_C2971        CDS       T00738                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase (NADP+)
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00250  Alanine, aspartate and glutamate metabolism
seh00310  Lysine degradation
seh00350  Tyrosine metabolism
seh00650  Butanoate metabolism
seh00760  Nicotinate and nicotinamide metabolism
seh01100  Metabolic pathways
seh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SeHA_C2971
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SeHA_C2971
   00310 Lysine degradation
    SeHA_C2971
   00350 Tyrosine metabolism
    SeHA_C2971
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SeHA_C2971
Enzymes [BR:seh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SeHA_C2971
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SeHA_C2971
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SeHA_C2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACF69245
LinkDB All DBs
Position
2914645..2916093
Genome map
AA seq 482 aa AA seqDB search
MQLNDSTLFRQQAFIDGDWRDARGGDVIPVSNPANGKPLGNVPKMGAEETRDAINAANRA
LPAWRALTAKERANILRRWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFA
EEGKRIYGDTIPGHQADKRLLVIKQPIGVTAAITPWNFPSAMITRKAGPALAAGCTMVLK
PASQTPFSALALAELAQRAGIPAGVFNVVTGSAGDIGGELTSNPLVRKLSFTGSTEIGRQ
LMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDG
VYDRFAEKLNQAVNKLAVGDGLQADVAIGPLIDEKAVAKVQEHIADALEKGARVITGGEA
HKLGGNFFQPTILADVPDNAKVAKEETFGPLAPLFRFSDEADVIRQANDTEFGLAAYFYA
RDLSRVFRVGEALEYGIVGINTGIISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCI
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaacgactctaccctgttccgccagcaggcctttatcgatggcgactggcgc
gacgcgcgcggcggcgatgtcatccccgtgagcaaccccgccaacgggaaaccgctcggc
aatgtgcccaaaatgggggcggaagagacgcgcgacgccatcaacgctgccaatcgcgcc
ctgcccgcctggcgcgcgctcaccgccaaagagcgagccaatatcctgcgtcgctggttc
aatctgatgatggaacatcaggacgatttggcgcgtctgatgacgctggaacagggtaaa
ccgctggcggaagcgaaaggcgaaattagctacgccgcctcgtttattgaatggttcgcc
gaagaggggaagcgtatctatggcgacacgattccaggccatcaggccgataaacggctg
ctggtgattaaacagcccatcggcgtcaccgccgcgattaccccgtggaactttccctcg
gcaatgatcacccgtaaagccggccccgcgctggccgcaggctgcacaatggtactcaaa
cccgccagccagacgccgttttccgcgctggcactggcggaactggcccagcgcgccgga
attcccgcaggcgtatttaacgtcgttaccggttcggcaggcgatatcggcggcgagctg
accagcaacccgctggtacgcaaactgtcgtttaccggctcgacggagattggccgccag
ctaatggaacaatgcgccaaagacattaaaaaagtgtcgctggaattgggcggcaatgcg
ccgtttatcgtctttgacgatgccgatctggataaagccgtcgaaggcgcgctggcttcg
aagtttcgcaacgccgggcagacctgtgtctgcgccaatagattgtatgttcaggacggc
gtttacgatcgttttgcggaaaaactcaaccaggcggtaaataagctcgcggtcggtgac
ggcctgcaagccgacgtcgctatcgggccgctgattgatgaaaaagccgtggcgaaagtc
caggaacatatcgccgatgcgctggaaaaaggcgcccgcgtcattacgggcggtgaagcg
cacaaattgggcggcaacttctttcaaccgaccattctggcggatgttcctgataacgcg
aaagtcgccaaagaagagacattcgggccgctcgcgcctctgttccgcttcagcgacgag
gcggatgtcatcaggcaggctaacgataccgagttcggcctggcagcctatttttatgca
cgcgatttaagccgcgttttccgcgtcggcgaagcgctggaatacggcattgtcggtatt
aataccggcattatctccaacgaagtcgcgcctttcggcggtattaaggcctccggatta
ggccgtgaaggttccaaatacggcatcgaagattatttagaaatcaaatatatgtgcatc
ggcctttaa

DBGET integrated database retrieval system