KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C3678Help
Entry
SeHA_C3678        CDS       T00738                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00061  Fatty acid biosynthesis
seh00620  Pyruvate metabolism
seh00640  Propanoate metabolism
seh01100  Metabolic pathways
seh01110  Biosynthesis of secondary metabolites
seh01120  Microbial metabolism in diverse environments
seh01130  Biosynthesis of antibiotics
seh01200  Carbon metabolism
seh01212  Fatty acid metabolism
Module
seh_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:seh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeHA_C3678 (accC)
   00640 Propanoate metabolism
    SeHA_C3678 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SeHA_C3678 (accC)
Enzymes [BR:seh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SeHA_C3678 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SeHA_C3678 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACF66425
LinkDB All DBs
Position
3564998..3566347
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLGDDMNANRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSITQDEVVVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNIDL
QTRIMNDEHFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttggataaaattgtcatcgccaaccgcggcgagatcgcactacgtattcttcgagcc
tgtaaagaactcggcatcaagaccgtcgctgtgcactcaagcgcggatcgcgatttaaaa
cacgtattgctggcggatgagacggtctgtattggcccggcaccgtccgtaaaaagttat
ctgaacatcccggctatcattagcgccgctgaaatcaccggcgcggtggcaatccacccg
ggttacggcttcctttctgagaacgccaattttgccgagcaggttgaacgctccggcttt
atctttatcggcccgaaagcggacaccatccgcctgatgggcgataaagtgtccgcgatt
accgcgatgaaaaaagcgggcgtgccgaccgtaccaggatctgacggcccgctgggcgac
gatatgaatgcgaaccgcgctcatgccaaacgtattggctatccggtgatcatcaaagcg
tccggcggcggcggcggccgcggtatgcgcgtagttcgtagcgatgctgaactggcgcag
tccatctccatgaccaaagcggaagcgaaagcagctttcagcaacgacatggtatacatg
gaaaaatacctggaaaatccacgccacatcgaaattcaggtgctggcggacggccagggc
aacgctatctatctggcggaacgcgactgttccatgcagcgtcgccaccagaaagtggtt
gaagaagccccggcgccaggcattacgccggaactgcgtcgctatatcggcgaacgctgc
gcgaaagcgtgcgtagacatcggctatcgcggcgcagggacgttcgaattcctgttcgaa
aacggcgagttctatttcatcgaaatgaacacccgtattcaggttgaacacccggtgact
gaaatgattaccggcgtcgatttgatcaaagagcagttgcgcatcgcggcgggtcagccg
ctgtcgatcacacaggacgaagttgtcgttcgaggccatgcggtagaatgccgtatcaat
gccgaagatccgaacaccttcctgccaagcccaggcaaaatcacgcgcttccatgcgcct
ggcggctttggcgttcgctgggaatctcatatctacgcgggctacacggtgccgccgtac
tatgattccatgatcggcaagctcatctgctacggtgaaaaccgcgacgtggcgattgcc
cgtatgaaaaatgccctgcaggaactgattatcgatggtatcaaaaccaatatcgatctg
cagacccgcatcatgaatgacgagcacttccagcacggtggaaccaacatccactatctg
gagaaaaaactcggtcttcaggaaaagtaa

DBGET integrated database retrieval system