KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0139Help
Entry
SPC_0139          CDS       T00862                                 

Gene name
ddl
Definition
(GenBank) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00473  D-Alanine metabolism
sei00550  Peptidoglycan biosynthesis
sei01100  Metabolic pathways
sei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPC_0139 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPC_0139 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SPC_0139 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sei01011]
    SPC_0139 (ddl)
Enzymes [BR:sei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPC_0139 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sei01011]
 Precursor biosynthesis
  Amino acid ligase
   SPC_0139 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACN44330
UniProt: C0Q5I8
LinkDB All DBs
Position
146948..147868
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFI
ALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENALQGALSLAFQHDDEILIE
KWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLEASQEAALQSL
VLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSLSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtcctgttgggcggaacctctgcggagcgggacgtttcgtta
aattccggcgcggcagtgttggccgggttacgtgaaggcggtattgatgcgcatcccgtc
gatccgcaagaggtcgatgtcgcgcagcttaaagcaatgggctttcagaaggtctttatt
gcgttgcatggccgtggcggtgaagatggcaccttacagggaatgcttgaactgctcggc
ctgccttataccggcagcggcgtgatggcctcggcgctttcaatggataaactgcgcagt
aaattgctgtggcagggcgcaggcttaccggttgccccgtgggtcgcgctgacgcgcgct
gagtttgaaaaaggccttagcgaagaacaaaaagcgcgaatttcggcgctgggtttaccg
ctgatcgtcaaacccagccgtgaaggctccagcgtcggtatgacgaaagtagtagaagaa
aatgctttacagggtgcgttatcattggcttttcagcatgatgacgaaatactgattgag
aaatggctgtgcggtccggaatttacggtggcgatagttggcgaagaaattttaccgtca
attcgtatccaaccggcaggaaccttctatgattatgaggcgaagtatctctctgatgag
actcagtatttctgccctgccggtttagaagcgtcccaggaagccgcgctacagtctctc
gtcctgcaggcatggaaagctttaggctgcacgggatgggggcgtattgacgtcatgctg
gacagcgatggtcagttttatctgctggaagccaatacttctccggggatgaccagccat
agtctggtgccgatggcggcgcgtcaggcgggaatgagcctctcgcagttagtggtacga
attctggagttggcggactga

DBGET integrated database retrieval system