KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1428Help
Entry
SPC_1428          CDS       T00862                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase (anaerobic), large subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00564  Glycerophospholipid metabolism
sei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPC_1428 (glpA)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SPC_1428 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DAO_C Thi4 3HCDH_N HI0933_like NAD_binding_8 Lycopene_cycl Pyr_redox_3 FtsA SO_alpha_A3 GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACN45589
UniProt: C0Q085
LinkDB All DBs
Position
complement(1488481..1490109)
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDDLAFQATFIRACEAAGIRAEA
IDPQQARIIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATVCGVHVRNHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLEGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTP
GWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaagcaagtgacgtgattatcattggcggtggagcaacaggc
gcagggatcgcccgcgactgcgcgctgcgcggtttacgtgtcattctggtggaacggcat
gatatagcgaccggcgcgaccgggcgtaaccacggactgctgcacagcggcgctcgttat
gcggttaccgacgcggaatccgcgcgcgagtgcattagtgaaaaccagattttaaaacgg
atcgcccgccattgcgtcgaaccgacggatggtctgtttattacgttgccggaagatgat
cttgcgtttcaggccacctttattcgcgcctgtgaagcggcgggcattcgcgctgaagcc
atcgatccgcagcaggctcgcatcatcgaaccttccgttaaccctgcgctcatcggtgcg
gtaaaagtgccggatggcaccgtggaccctttccgccttaccgccgccaatatgctggat
gccagagaacatggcgcaatcgtgttaacggcgcatgaagtgaccgggctcattcgtgaa
ggcgcaacggtctgcggcgtccatgtgcgcaaccatctcactggcgaaacccagacgctt
cacgcgccggtggtggtcaatgcggcaggtatctgggggcaacggatcgccgaatacgcc
gacctgagtattcgcatgttcccggcgaaaggctcgctgttgatcatggaccatcggatc
aaccagcatgtcattaaccgctgccggaaaccatcggatgccgacattctggtacctggc
gatacgatttcactgatcggcaccacctctacccatattgattacaatgagatagacagc
aaccgcgtcaccgcagatgaagtcgatatcctgctgcgtgaaggggaaaaactggcccct
gtcatggcgaagacgcgtattctgcgcgcgtattccggcgtccgcccgctggtggccagc
gatgacgatcccagtggtcgtaacgtcagccgcggtattgtgttgttcgaccacgccgag
cgcgacgggcttgaaggcttcattaccattaccggcgggaagctaatgacttaccgcctg
atggcggaatgggcgaccgatgccgtgtgccgcaagttgggcaatactcgcccctgcatc
acggcggatacgccgttgcctggctcaaaagagtctacagaacatacgctgaaacgcatt
atctcgcttcccgcgccgctacgcggatcggcggtttatcggcatggcgatcgcacgccg
gggtggctgagtgaaggccgccaacaccgtagcctggtctgtgaatgcgaggccgtcacg
gcgggggaagtgcagtatgccgtcgaaaacttaaccgtgaatagcctgctggatctgcgc
cgtcgcacccgcgtagggatgggcacttgccagggcgagctatgcgcctgccgcgcagcc
gggctattgcagcgttttaatgtgacgaccgcggcgcaatctattacgcaactctctgaa
tttctgaatgagcgctggaaaggcgtacaacctgtcgcctggggagacgcgctgcgcgaa
agcgaattcacgcgctgggtttatcagggattatgcggtctggagaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system