KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2291Help
Entry
SPC_2291          CDS       T00862                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Brite
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPC_2291 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACN46408
UniProt: C0Q5U2
LinkDB All DBs
Structure
PDB: 

Position
complement(2349627..2350148)
Genome map
AA seq 173 aa AA seqDB search
MKRLSLAMVTLLACAGAQAASEKVEMNLVTAQGVGQSIGTVVIDETEGGLKFTPHLKALP
PGEHGFHIHANGSCQPAIKDGQAVAAEAAGGHLDPQNTGKHEGPEGQGHLGDLPVLVVNN
DGIATEPVTAPRLKSLDEVKDKALMIHVGGDNMSDQPKPLGGGGTRYACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattaagtttagcgatggtgacgctgctggcctgtgcgggtgcgcaggctgcc
agcgagaaagtagagatgaatctggtgacggcgcaaggcgtaggacagtctatcggcacc
gtcgtcatcgatgaaaccgaaggcggcttaaaatttaccccacaccttaaagcgttgccg
ccgggcgagcatggttttcacattcatgccaacggtagctgccagccagcgattaaagac
ggccaagcggttgccgcagaagccgctggtggtcatctggacccacaaaataccggcaag
catgaaggaccggaaggccaggggcatctgggcgacctcccggtgttagtcgttaataat
gatggtatcgccaccgaaccggttactgcgccgcgtctgaagtctcttgatgaagtgaaa
gataaagcgctcatgatccatgtgggcggcgataacatgtccgatcagccgaaaccgctc
ggcggcggcggaacgcgttacgcctgcggcgtcattaaataa

DBGET integrated database retrieval system