KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2445Help
Entry
SPC_2445          CDS       T00862                                 

Definition
(GenBank) hypothetical zinc-type alcohol dehydrogenase-like protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_3 ThiF
Motif
Other DBs
NCBI-ProteinID: ACN46554
UniProt: C0Q6Z6
LinkDB All DBs
Position
complement(2499159..2500202)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKMPGTMKIIAADIPVPKDNEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVIAVGNRVSKFKPVDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMETQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATNIAVVDVLEKRLAMAERLGATTVINGAKEDTVARCQQFTDDMGADI
VFETAGSAVTTQQAPYLVMHGGKIMIVGTVAGDSAINFLKINREVSIQTVFRYANRYPVT
IDAISSGRFDVKSMVTHIYDYKDVQRAFEESVNNKRDIIKGVIKVCD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaatgccgggcaccatgaaaattatcgcagcggat
attccggtgccaaaagataacgaagtgctgatcaaagtggaatatgtcggtatttgcggt
tcagatgttcacggttttgaatccgggccattcattccgccgaaggatccaaatcaggaa
attggcctggggcatgagtgtgccggaacggtcattgcggtcggcaatcgggtaagcaaa
tttaagccagtcgatcgggttaatatcgagccgggcgtgccgtgcggccactgccgctat
tgtctggaaggaaaatacaatatttgtccggatgttgattttatggagacgcagccgaat
tatcgcggggccttaacgcactatctgtgccatccggaaagttttacgtacaagcttccg
gacaatatggacactatggaaggtgcgctggtggaacctgctgctgttggaatgcacgcg
gcaatgctggcggatgttaaaccgggtaagaaaatcgtcattctcggcgcgggctgcatt
ggtttaatgaccctgcaagcgtgtaagtgtctgggggcgaccaatatcgcggtagtggat
gtgctggaaaaacggctggcaatggctgaacgactgggagcgacaaccgttatcaatggg
gcgaaagaagatactgtcgcgcgctgccagcagttcaccgacgatatgggcgccgatatt
gtgtttgaaaccgccggttccgccgtcacaactcagcaagcgccgtatctggtcatgcac
ggcgggaagatcatgattgtcggcactgtcgcgggagattcagcgattaatttcctcaaa
attaaccgtgaagtctccatccagacggtattccgctatgccaaccgctatccggtgact
attgatgccatctcctccgggcgtttcgatgtgaaatcaatggtgacgcatatttacgat
tacaaagacgtacaacgtgcatttgaagagtcggtgaataacaaacgcgacattattaaa
ggcgttattaaagtttgcgattaa

DBGET integrated database retrieval system